Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QXI2

Protein Details
Accession A0A2Z6QXI2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-97LNLFRTRRRFAKIRRFKRNCVFIKSHydrophilic
NLS Segment(s)
PositionSequence
84-84K
Subcellular Location(s) extr 9, mito 8, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019954  Ubiquitin_CS  
IPR019956  Ubiquitin_dom  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS00299  UBIQUITIN_1  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MSNQVLLSAALSAITNSTILPLYDDYSGNNQSNPYNSYYRYNQYNQLDETSLHQSHLIGGKVPTSDVNGNEQLNLFRTRRRFAKIRRFKRNCVFIKSLTGKTITVNVNFNETIDQLKTKIQATEGIPPNQQRLIFSGQVVKDDSTLTDCNIQCESTLYLLRIRGGGSPSNTLFIHSDQLDPKYDYDFTNINDNGITFMRGNFEYKRPCGWKRIALNVLNKYEDNTWLGVDNRQYSTSSVVNEWPVSYHGTAKHNCKSIAEDGYLLCKGKRFLFGYGIYSTPDIDVAYQYATKFTHDGDEYRVVFQNRVNPNNLIRIPKYETRVGEYWISPDGADLRPYGICIKKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.08
5 0.08
6 0.08
7 0.1
8 0.11
9 0.12
10 0.15
11 0.15
12 0.16
13 0.21
14 0.26
15 0.25
16 0.25
17 0.25
18 0.24
19 0.28
20 0.28
21 0.28
22 0.27
23 0.28
24 0.34
25 0.37
26 0.41
27 0.45
28 0.46
29 0.49
30 0.5
31 0.53
32 0.48
33 0.46
34 0.41
35 0.35
36 0.35
37 0.33
38 0.29
39 0.24
40 0.22
41 0.19
42 0.22
43 0.25
44 0.22
45 0.17
46 0.17
47 0.18
48 0.18
49 0.19
50 0.16
51 0.15
52 0.17
53 0.17
54 0.22
55 0.23
56 0.23
57 0.23
58 0.23
59 0.21
60 0.21
61 0.25
62 0.21
63 0.23
64 0.27
65 0.32
66 0.37
67 0.43
68 0.49
69 0.55
70 0.65
71 0.71
72 0.77
73 0.83
74 0.85
75 0.86
76 0.86
77 0.86
78 0.81
79 0.78
80 0.72
81 0.63
82 0.65
83 0.61
84 0.53
85 0.45
86 0.4
87 0.32
88 0.28
89 0.33
90 0.26
91 0.23
92 0.24
93 0.22
94 0.25
95 0.24
96 0.23
97 0.18
98 0.15
99 0.15
100 0.13
101 0.13
102 0.1
103 0.12
104 0.14
105 0.15
106 0.15
107 0.14
108 0.18
109 0.19
110 0.28
111 0.31
112 0.31
113 0.32
114 0.32
115 0.34
116 0.31
117 0.29
118 0.2
119 0.19
120 0.21
121 0.19
122 0.19
123 0.22
124 0.2
125 0.21
126 0.22
127 0.18
128 0.14
129 0.14
130 0.13
131 0.11
132 0.11
133 0.11
134 0.16
135 0.16
136 0.17
137 0.17
138 0.17
139 0.14
140 0.15
141 0.15
142 0.1
143 0.11
144 0.1
145 0.11
146 0.12
147 0.12
148 0.11
149 0.11
150 0.11
151 0.12
152 0.13
153 0.13
154 0.15
155 0.15
156 0.17
157 0.16
158 0.15
159 0.14
160 0.13
161 0.14
162 0.12
163 0.13
164 0.12
165 0.14
166 0.15
167 0.15
168 0.15
169 0.14
170 0.15
171 0.13
172 0.14
173 0.15
174 0.14
175 0.2
176 0.19
177 0.18
178 0.17
179 0.16
180 0.15
181 0.14
182 0.14
183 0.07
184 0.07
185 0.09
186 0.1
187 0.12
188 0.13
189 0.18
190 0.21
191 0.23
192 0.28
193 0.32
194 0.34
195 0.39
196 0.41
197 0.44
198 0.44
199 0.5
200 0.51
201 0.5
202 0.55
203 0.53
204 0.51
205 0.45
206 0.4
207 0.34
208 0.29
209 0.25
210 0.19
211 0.14
212 0.12
213 0.12
214 0.13
215 0.14
216 0.15
217 0.17
218 0.16
219 0.17
220 0.18
221 0.17
222 0.19
223 0.19
224 0.18
225 0.16
226 0.17
227 0.17
228 0.17
229 0.16
230 0.13
231 0.13
232 0.14
233 0.13
234 0.15
235 0.18
236 0.24
237 0.28
238 0.35
239 0.39
240 0.41
241 0.41
242 0.39
243 0.39
244 0.37
245 0.36
246 0.3
247 0.26
248 0.22
249 0.25
250 0.25
251 0.21
252 0.17
253 0.16
254 0.17
255 0.18
256 0.25
257 0.24
258 0.25
259 0.3
260 0.32
261 0.33
262 0.32
263 0.3
264 0.25
265 0.22
266 0.2
267 0.14
268 0.13
269 0.09
270 0.08
271 0.08
272 0.08
273 0.09
274 0.1
275 0.1
276 0.12
277 0.13
278 0.14
279 0.14
280 0.14
281 0.19
282 0.19
283 0.2
284 0.23
285 0.3
286 0.3
287 0.32
288 0.36
289 0.31
290 0.31
291 0.32
292 0.36
293 0.37
294 0.4
295 0.41
296 0.4
297 0.42
298 0.49
299 0.5
300 0.47
301 0.41
302 0.42
303 0.45
304 0.48
305 0.5
306 0.47
307 0.46
308 0.46
309 0.46
310 0.44
311 0.42
312 0.37
313 0.34
314 0.29
315 0.28
316 0.2
317 0.2
318 0.2
319 0.17
320 0.18
321 0.16
322 0.16
323 0.16
324 0.18
325 0.23
326 0.25