Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QAR2

Protein Details
Accession A0A2Z6QAR2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-132FAPRKTIKEWLRRKPRKDAEKLKKKETABasic
NLS Segment(s)
PositionSequence
108-129RKTIKEWLRRKPRKDAEKLKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000591  DEP_dom  
IPR045838  DEPDC5_CTD  
IPR027244  IML1  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005774  C:vacuolar membrane  
GO:0005096  F:GTPase activator activity  
GO:0035556  P:intracellular signal transduction  
Pfam View protein in Pfam  
PF00610  DEP  
PF19418  DEPDC5_CTD  
PROSITE View protein in PROSITE  
PS50186  DEP  
Amino Acid Sequences MDRKRENSSPHLRPTTDDLSIFVITPDGLYPRRSSDRQWHFKAYQNAIVGNEFVDWLISRFHDIDTRASAVAFGNELLDRGLFEHCQRRHRFLDGFYFYQINEEFAPRKTIKEWLRRKPRKDAEKLKKKETAILHYDVIYNVDTCYHFQLNWLACTARLIEELLQQWGRNAEKYGLKLVEAPVEQAMSLTDNNPFQSPTSIKLSLLPPTLEELEKLGKKLNPEINHNLYFEIELVKHFKFVLDVEADNRFPKEVDIIYSYHKTPYKYSQYIHRSGVAFIQICDPGEGFLWVNNRIYTTHNISNKNTSSPNPDLLLKEFQNFCNDKVALKKFWDDVVNSIVDFIYEPNVTEQRPDSMTKGNSGNESESSLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.51
4 0.43
5 0.35
6 0.31
7 0.31
8 0.28
9 0.2
10 0.15
11 0.11
12 0.12
13 0.11
14 0.12
15 0.13
16 0.15
17 0.17
18 0.23
19 0.31
20 0.33
21 0.38
22 0.45
23 0.54
24 0.62
25 0.66
26 0.68
27 0.64
28 0.7
29 0.73
30 0.67
31 0.62
32 0.55
33 0.5
34 0.43
35 0.4
36 0.32
37 0.23
38 0.18
39 0.12
40 0.09
41 0.08
42 0.07
43 0.07
44 0.08
45 0.08
46 0.11
47 0.11
48 0.13
49 0.16
50 0.18
51 0.2
52 0.22
53 0.24
54 0.21
55 0.2
56 0.2
57 0.16
58 0.15
59 0.12
60 0.09
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.06
67 0.07
68 0.09
69 0.09
70 0.13
71 0.22
72 0.26
73 0.36
74 0.4
75 0.45
76 0.47
77 0.52
78 0.52
79 0.46
80 0.52
81 0.48
82 0.45
83 0.4
84 0.37
85 0.31
86 0.3
87 0.27
88 0.18
89 0.14
90 0.15
91 0.15
92 0.16
93 0.22
94 0.2
95 0.21
96 0.21
97 0.29
98 0.35
99 0.43
100 0.52
101 0.57
102 0.68
103 0.75
104 0.79
105 0.81
106 0.83
107 0.83
108 0.83
109 0.84
110 0.84
111 0.86
112 0.86
113 0.82
114 0.78
115 0.69
116 0.65
117 0.58
118 0.54
119 0.48
120 0.45
121 0.39
122 0.33
123 0.33
124 0.27
125 0.23
126 0.16
127 0.11
128 0.08
129 0.09
130 0.08
131 0.09
132 0.12
133 0.12
134 0.11
135 0.12
136 0.18
137 0.18
138 0.18
139 0.18
140 0.14
141 0.13
142 0.14
143 0.14
144 0.09
145 0.08
146 0.08
147 0.08
148 0.1
149 0.11
150 0.13
151 0.13
152 0.12
153 0.12
154 0.14
155 0.14
156 0.12
157 0.12
158 0.13
159 0.15
160 0.16
161 0.19
162 0.17
163 0.16
164 0.17
165 0.16
166 0.16
167 0.14
168 0.13
169 0.1
170 0.1
171 0.09
172 0.08
173 0.07
174 0.05
175 0.05
176 0.05
177 0.07
178 0.07
179 0.08
180 0.09
181 0.09
182 0.08
183 0.11
184 0.12
185 0.13
186 0.18
187 0.18
188 0.18
189 0.2
190 0.21
191 0.21
192 0.22
193 0.19
194 0.14
195 0.15
196 0.17
197 0.13
198 0.12
199 0.11
200 0.14
201 0.15
202 0.15
203 0.17
204 0.17
205 0.18
206 0.25
207 0.29
208 0.28
209 0.33
210 0.39
211 0.42
212 0.42
213 0.41
214 0.35
215 0.29
216 0.26
217 0.2
218 0.15
219 0.09
220 0.08
221 0.11
222 0.11
223 0.11
224 0.11
225 0.11
226 0.1
227 0.11
228 0.13
229 0.11
230 0.12
231 0.13
232 0.16
233 0.17
234 0.17
235 0.16
236 0.13
237 0.11
238 0.11
239 0.12
240 0.1
241 0.12
242 0.13
243 0.15
244 0.18
245 0.21
246 0.21
247 0.23
248 0.26
249 0.25
250 0.26
251 0.34
252 0.4
253 0.41
254 0.43
255 0.48
256 0.52
257 0.56
258 0.54
259 0.5
260 0.41
261 0.37
262 0.38
263 0.32
264 0.25
265 0.21
266 0.21
267 0.17
268 0.17
269 0.16
270 0.14
271 0.1
272 0.1
273 0.11
274 0.08
275 0.1
276 0.12
277 0.14
278 0.15
279 0.15
280 0.16
281 0.16
282 0.19
283 0.22
284 0.26
285 0.32
286 0.37
287 0.42
288 0.44
289 0.51
290 0.49
291 0.48
292 0.44
293 0.4
294 0.41
295 0.4
296 0.41
297 0.35
298 0.36
299 0.34
300 0.34
301 0.38
302 0.31
303 0.34
304 0.33
305 0.32
306 0.38
307 0.37
308 0.35
309 0.36
310 0.35
311 0.32
312 0.38
313 0.43
314 0.38
315 0.39
316 0.42
317 0.35
318 0.39
319 0.41
320 0.33
321 0.31
322 0.3
323 0.28
324 0.24
325 0.22
326 0.18
327 0.14
328 0.13
329 0.1
330 0.1
331 0.1
332 0.11
333 0.15
334 0.19
335 0.19
336 0.22
337 0.23
338 0.24
339 0.26
340 0.28
341 0.27
342 0.32
343 0.34
344 0.36
345 0.39
346 0.37
347 0.37
348 0.38
349 0.37
350 0.3
351 0.33