Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RC79

Protein Details
Accession A0A2Z6RC79    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-60ILLTKSQKRSAKKKVCKERQKLHLQTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSINIDMIDEDLKGLLDDKLSATLLRNNTSLSVILLTKSQKRSAKKKVCKERQKLHLQTPSRLDEQVVPTFSAESPEYTPSKPSGSRTITFNQSLLSPPSTPYKQQLKRDFKLQSTLINNGKKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.1
7 0.1
8 0.11
9 0.11
10 0.16
11 0.19
12 0.21
13 0.21
14 0.19
15 0.2
16 0.2
17 0.18
18 0.14
19 0.12
20 0.1
21 0.1
22 0.12
23 0.14
24 0.19
25 0.22
26 0.28
27 0.32
28 0.4
29 0.49
30 0.58
31 0.66
32 0.7
33 0.78
34 0.82
35 0.87
36 0.9
37 0.9
38 0.88
39 0.86
40 0.87
41 0.82
42 0.78
43 0.76
44 0.68
45 0.62
46 0.57
47 0.51
48 0.41
49 0.36
50 0.29
51 0.23
52 0.24
53 0.23
54 0.19
55 0.16
56 0.15
57 0.16
58 0.15
59 0.14
60 0.11
61 0.1
62 0.1
63 0.13
64 0.15
65 0.15
66 0.17
67 0.16
68 0.19
69 0.19
70 0.21
71 0.26
72 0.3
73 0.31
74 0.34
75 0.37
76 0.38
77 0.37
78 0.34
79 0.27
80 0.22
81 0.23
82 0.22
83 0.19
84 0.15
85 0.16
86 0.23
87 0.25
88 0.26
89 0.32
90 0.4
91 0.46
92 0.56
93 0.65
94 0.68
95 0.69
96 0.76
97 0.74
98 0.66
99 0.66
100 0.57
101 0.55
102 0.49
103 0.53
104 0.52
105 0.52