Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S6N3

Protein Details
Accession A0A2Z6S6N3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
185-204EFKNKNNKVNEPKVSKKKIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
Amino Acid Sequences MALSEKELAKCDYRRRTILLAYNPNCITKSQQLLEWAISNIIRPNLDHVYIFSVLPPQKLYYPVIDVWTFGLVGYANTYTTTTNHDDYQEYIKNEQESVKSTLRNISFQLKGKNVTSNIIISRGNVREELLKICESVKPDVVLIGSSPSSSSSSKVKNLLNRSTFDYIKNNVKNIEVQSNVEHEEFKNKNNKVNEPKVSKKKIYRAIQDVMKQIKPKSCDTSVGPTNPNKSYHKLYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.59
4 0.6
5 0.61
6 0.61
7 0.62
8 0.57
9 0.6
10 0.56
11 0.53
12 0.46
13 0.39
14 0.35
15 0.31
16 0.36
17 0.3
18 0.32
19 0.34
20 0.35
21 0.36
22 0.32
23 0.26
24 0.2
25 0.19
26 0.17
27 0.16
28 0.16
29 0.15
30 0.13
31 0.18
32 0.19
33 0.2
34 0.19
35 0.17
36 0.2
37 0.2
38 0.2
39 0.15
40 0.19
41 0.19
42 0.2
43 0.2
44 0.17
45 0.18
46 0.21
47 0.22
48 0.18
49 0.2
50 0.2
51 0.22
52 0.2
53 0.19
54 0.17
55 0.15
56 0.13
57 0.09
58 0.09
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.13
69 0.15
70 0.16
71 0.17
72 0.18
73 0.18
74 0.19
75 0.24
76 0.24
77 0.22
78 0.22
79 0.23
80 0.22
81 0.22
82 0.22
83 0.18
84 0.17
85 0.21
86 0.23
87 0.21
88 0.21
89 0.26
90 0.25
91 0.25
92 0.23
93 0.23
94 0.24
95 0.27
96 0.3
97 0.27
98 0.28
99 0.27
100 0.29
101 0.25
102 0.22
103 0.2
104 0.18
105 0.16
106 0.16
107 0.15
108 0.11
109 0.15
110 0.15
111 0.14
112 0.13
113 0.13
114 0.13
115 0.14
116 0.15
117 0.13
118 0.12
119 0.12
120 0.13
121 0.14
122 0.14
123 0.14
124 0.14
125 0.12
126 0.12
127 0.12
128 0.11
129 0.1
130 0.07
131 0.07
132 0.06
133 0.06
134 0.06
135 0.07
136 0.09
137 0.1
138 0.11
139 0.15
140 0.19
141 0.22
142 0.28
143 0.3
144 0.34
145 0.41
146 0.47
147 0.45
148 0.43
149 0.46
150 0.45
151 0.42
152 0.39
153 0.37
154 0.33
155 0.39
156 0.4
157 0.36
158 0.33
159 0.33
160 0.34
161 0.32
162 0.33
163 0.26
164 0.25
165 0.24
166 0.25
167 0.26
168 0.23
169 0.21
170 0.16
171 0.24
172 0.23
173 0.28
174 0.35
175 0.35
176 0.42
177 0.46
178 0.55
179 0.56
180 0.64
181 0.67
182 0.66
183 0.75
184 0.78
185 0.81
186 0.79
187 0.78
188 0.78
189 0.79
190 0.8
191 0.78
192 0.75
193 0.74
194 0.72
195 0.69
196 0.67
197 0.63
198 0.58
199 0.54
200 0.51
201 0.5
202 0.48
203 0.49
204 0.48
205 0.46
206 0.46
207 0.47
208 0.51
209 0.52
210 0.54
211 0.53
212 0.51
213 0.54
214 0.53
215 0.54
216 0.5
217 0.49