Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R2T7

Protein Details
Accession A0A2Z6R2T7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-41FKEIRHSRKIQEKMKGRRNKDKRSEDKTEKKNEBasic
NLS Segment(s)
PositionSequence
13-39RHSRKIQEKMKGRRNKDKRSEDKTEKK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences MKPNTYLVFKEIRHSRKIQEKMKGRRNKDKRSEDKTEKKNEIERDKDEIERIIAIFPIRGSRFVIQYKTKLLRWMLIFYRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.55
4 0.64
5 0.63
6 0.64
7 0.69
8 0.74
9 0.8
10 0.82
11 0.8
12 0.81
13 0.84
14 0.85
15 0.85
16 0.85
17 0.85
18 0.84
19 0.86
20 0.85
21 0.85
22 0.82
23 0.8
24 0.73
25 0.66
26 0.64
27 0.62
28 0.59
29 0.54
30 0.48
31 0.45
32 0.43
33 0.41
34 0.36
35 0.29
36 0.22
37 0.18
38 0.15
39 0.1
40 0.09
41 0.08
42 0.08
43 0.07
44 0.12
45 0.12
46 0.13
47 0.16
48 0.17
49 0.23
50 0.26
51 0.32
52 0.32
53 0.34
54 0.42
55 0.44
56 0.44
57 0.45
58 0.43
59 0.43
60 0.41
61 0.44
62 0.43