Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R1P8

Protein Details
Accession A0A2Z6R1P8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MERGKPKWKGEKRNGREGKTBasic
50-99GEGKNERGGKKRKKREKRKGEKRKGRGKKRGKGKGKTKGKGKKRWKEKGKBasic
NLS Segment(s)
PositionSequence
3-34RGKPKWKGEKRNGREGKTEREERERGKTKGKG
50-99GEGKNERGGKKRKKREKRKGEKRKGRGKKRGKGKGKTKGKGKKRWKEKGK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MERGKPKWKGEKRNGREGKTEREERERGKTKGKGENVGENENEMEGEKEGEGKNERGGKKRKKREKRKGEKRKGRGKKRGKGKGKTKGKGKKRWKEKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.79
4 0.73
5 0.72
6 0.69
7 0.7
8 0.63
9 0.63
10 0.64
11 0.59
12 0.64
13 0.62
14 0.57
15 0.58
16 0.59
17 0.58
18 0.61
19 0.6
20 0.57
21 0.51
22 0.56
23 0.5
24 0.47
25 0.4
26 0.32
27 0.28
28 0.21
29 0.18
30 0.11
31 0.08
32 0.05
33 0.05
34 0.05
35 0.07
36 0.07
37 0.09
38 0.11
39 0.11
40 0.14
41 0.21
42 0.23
43 0.29
44 0.39
45 0.48
46 0.57
47 0.67
48 0.74
49 0.79
50 0.89
51 0.92
52 0.94
53 0.94
54 0.95
55 0.96
56 0.97
57 0.96
58 0.95
59 0.95
60 0.94
61 0.94
62 0.93
63 0.93
64 0.9
65 0.9
66 0.91
67 0.9
68 0.9
69 0.89
70 0.89
71 0.89
72 0.89
73 0.88
74 0.88
75 0.88
76 0.89
77 0.89
78 0.89
79 0.9