Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QVZ4

Protein Details
Accession A0A2Z6QVZ4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-40PSGSSNTTPKDKKKKKVPEKSVEKIFVHydrophilic
NLS Segment(s)
PositionSequence
23-31KDKKKKKVP
Subcellular Location(s) nucl 19.5, mito_nucl 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MQNANNDQPILSQPSGSSNTTPKDKKKKKVPEKSVEKIFVDTNIPDEKFNNIRDIFVYDVPSSWSHNKILAELKAWGDPISMTVKKQRKYQTLQIKICLSTFTLASFEQGIWQYSLGDISIRWFPEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.26
5 0.24
6 0.29
7 0.37
8 0.43
9 0.47
10 0.55
11 0.63
12 0.7
13 0.76
14 0.83
15 0.86
16 0.9
17 0.91
18 0.91
19 0.91
20 0.89
21 0.86
22 0.79
23 0.69
24 0.6
25 0.5
26 0.4
27 0.32
28 0.24
29 0.19
30 0.18
31 0.18
32 0.16
33 0.17
34 0.19
35 0.21
36 0.22
37 0.24
38 0.2
39 0.2
40 0.2
41 0.21
42 0.19
43 0.16
44 0.18
45 0.12
46 0.12
47 0.13
48 0.13
49 0.14
50 0.14
51 0.15
52 0.13
53 0.16
54 0.16
55 0.16
56 0.19
57 0.17
58 0.17
59 0.16
60 0.16
61 0.14
62 0.14
63 0.12
64 0.09
65 0.08
66 0.09
67 0.13
68 0.13
69 0.14
70 0.22
71 0.29
72 0.33
73 0.4
74 0.47
75 0.49
76 0.56
77 0.64
78 0.67
79 0.71
80 0.7
81 0.68
82 0.63
83 0.55
84 0.49
85 0.4
86 0.3
87 0.2
88 0.17
89 0.12
90 0.12
91 0.11
92 0.12
93 0.12
94 0.1
95 0.13
96 0.14
97 0.14
98 0.13
99 0.13
100 0.12
101 0.12
102 0.12
103 0.09
104 0.08
105 0.07
106 0.09
107 0.13