Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CQN3

Protein Details
Accession A1CQN3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
491-513SLVAIPKKYKVRFIPKNAKALARHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, golg 5, E.R. 3, cyto 2, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR002401  Cyt_P450_E_grp-I  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0044249  P:cellular biosynthetic process  
GO:1901362  P:organic cyclic compound biosynthetic process  
GO:0044550  P:secondary metabolite biosynthetic process  
GO:0044283  P:small molecule biosynthetic process  
KEGG act:ACLA_026760  -  
Pfam View protein in Pfam  
PF00067  p450  
CDD cd11066  CYP_PhacA-like  
Amino Acid Sequences MAITAALSFVQYSILHYPLQSFAAAVLIVPFIYVIANEFIRASVRVPGFEGPRGLPLIGNLAQIRKNAAEQYRIWSKTYGPVYQIQLGNIPVIVVNSAAAAKVLFGQNAQALSSRPEFYTFHKIVSNTAGTTIGTSPYSESLKRRRKGAASALNRPSVDSYVSHLDVESKAFVAELYKYGHSGKTPVDPMAMIQRLSLSLSLTLNWGVRVASQEEDLFNEITHVEEEISKFRSTTGNLQDYIPLLRLNPFSSNSRKAKEMRQRRDKYLGALNRDLDDRMEKGIHKPCIQANVILDKEAKLNSEELISISLTMLSGGLDTVTTLVAWSICLLSRRPDIQEKAARAIHIMFTEDKPLCDSGDDQKCAYVAALVRECLRYYTVLRLALPRTSIRDITYDGKVIPKGTVFFLNAWACNMDPEIWSDPEEFRPERWFEQPDAPMFTYGMGYRMCAGSLLANRELYLVFMRTLNSFRIEPHDDVDWHPISGNSDPTSLVAIPKKYKVRFIPKNAKALARDLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.19
5 0.18
6 0.2
7 0.16
8 0.13
9 0.11
10 0.12
11 0.11
12 0.09
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.04
19 0.05
20 0.05
21 0.06
22 0.08
23 0.09
24 0.09
25 0.1
26 0.1
27 0.12
28 0.13
29 0.12
30 0.17
31 0.18
32 0.18
33 0.21
34 0.25
35 0.27
36 0.29
37 0.3
38 0.24
39 0.26
40 0.26
41 0.24
42 0.19
43 0.17
44 0.2
45 0.19
46 0.21
47 0.19
48 0.21
49 0.24
50 0.24
51 0.26
52 0.22
53 0.23
54 0.26
55 0.28
56 0.3
57 0.29
58 0.36
59 0.42
60 0.43
61 0.42
62 0.37
63 0.35
64 0.38
65 0.41
66 0.37
67 0.3
68 0.34
69 0.36
70 0.41
71 0.41
72 0.33
73 0.3
74 0.28
75 0.25
76 0.2
77 0.16
78 0.1
79 0.08
80 0.08
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.07
90 0.09
91 0.08
92 0.08
93 0.1
94 0.11
95 0.12
96 0.12
97 0.11
98 0.1
99 0.14
100 0.17
101 0.17
102 0.16
103 0.18
104 0.2
105 0.24
106 0.33
107 0.3
108 0.29
109 0.31
110 0.31
111 0.3
112 0.33
113 0.29
114 0.19
115 0.2
116 0.18
117 0.14
118 0.16
119 0.14
120 0.11
121 0.1
122 0.1
123 0.1
124 0.12
125 0.15
126 0.16
127 0.22
128 0.32
129 0.41
130 0.44
131 0.48
132 0.52
133 0.53
134 0.58
135 0.61
136 0.61
137 0.58
138 0.64
139 0.64
140 0.61
141 0.57
142 0.5
143 0.41
144 0.32
145 0.26
146 0.17
147 0.17
148 0.17
149 0.18
150 0.17
151 0.16
152 0.16
153 0.16
154 0.16
155 0.13
156 0.08
157 0.08
158 0.08
159 0.08
160 0.07
161 0.07
162 0.08
163 0.1
164 0.1
165 0.12
166 0.13
167 0.14
168 0.13
169 0.15
170 0.15
171 0.17
172 0.19
173 0.18
174 0.18
175 0.16
176 0.17
177 0.21
178 0.21
179 0.16
180 0.14
181 0.14
182 0.13
183 0.14
184 0.14
185 0.07
186 0.07
187 0.08
188 0.08
189 0.08
190 0.09
191 0.09
192 0.08
193 0.08
194 0.07
195 0.07
196 0.08
197 0.09
198 0.09
199 0.09
200 0.1
201 0.1
202 0.11
203 0.11
204 0.1
205 0.08
206 0.08
207 0.07
208 0.07
209 0.07
210 0.06
211 0.05
212 0.06
213 0.07
214 0.09
215 0.12
216 0.11
217 0.11
218 0.12
219 0.14
220 0.15
221 0.21
222 0.25
223 0.26
224 0.27
225 0.27
226 0.27
227 0.25
228 0.24
229 0.17
230 0.11
231 0.08
232 0.1
233 0.1
234 0.11
235 0.12
236 0.13
237 0.17
238 0.22
239 0.29
240 0.3
241 0.31
242 0.34
243 0.35
244 0.42
245 0.48
246 0.54
247 0.56
248 0.64
249 0.67
250 0.68
251 0.73
252 0.65
253 0.58
254 0.56
255 0.49
256 0.43
257 0.4
258 0.36
259 0.3
260 0.29
261 0.26
262 0.18
263 0.15
264 0.11
265 0.1
266 0.11
267 0.11
268 0.16
269 0.23
270 0.26
271 0.26
272 0.27
273 0.28
274 0.32
275 0.31
276 0.27
277 0.22
278 0.25
279 0.23
280 0.22
281 0.21
282 0.16
283 0.16
284 0.15
285 0.14
286 0.09
287 0.09
288 0.09
289 0.09
290 0.09
291 0.08
292 0.08
293 0.07
294 0.07
295 0.06
296 0.06
297 0.05
298 0.05
299 0.04
300 0.03
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.03
313 0.04
314 0.04
315 0.05
316 0.07
317 0.08
318 0.11
319 0.15
320 0.17
321 0.2
322 0.27
323 0.29
324 0.35
325 0.4
326 0.39
327 0.41
328 0.41
329 0.37
330 0.31
331 0.29
332 0.22
333 0.17
334 0.17
335 0.13
336 0.13
337 0.19
338 0.18
339 0.17
340 0.18
341 0.18
342 0.16
343 0.15
344 0.16
345 0.2
346 0.27
347 0.28
348 0.27
349 0.27
350 0.26
351 0.26
352 0.23
353 0.17
354 0.1
355 0.14
356 0.15
357 0.16
358 0.17
359 0.18
360 0.18
361 0.17
362 0.16
363 0.13
364 0.14
365 0.2
366 0.22
367 0.23
368 0.24
369 0.27
370 0.28
371 0.27
372 0.28
373 0.23
374 0.24
375 0.26
376 0.26
377 0.23
378 0.24
379 0.26
380 0.27
381 0.27
382 0.24
383 0.21
384 0.23
385 0.23
386 0.21
387 0.19
388 0.17
389 0.16
390 0.17
391 0.19
392 0.17
393 0.17
394 0.22
395 0.23
396 0.22
397 0.21
398 0.2
399 0.17
400 0.16
401 0.17
402 0.11
403 0.1
404 0.13
405 0.16
406 0.16
407 0.18
408 0.19
409 0.2
410 0.22
411 0.27
412 0.25
413 0.23
414 0.28
415 0.31
416 0.32
417 0.36
418 0.36
419 0.34
420 0.41
421 0.43
422 0.41
423 0.43
424 0.4
425 0.35
426 0.31
427 0.28
428 0.22
429 0.18
430 0.18
431 0.12
432 0.11
433 0.12
434 0.12
435 0.12
436 0.1
437 0.1
438 0.13
439 0.17
440 0.21
441 0.22
442 0.22
443 0.22
444 0.23
445 0.22
446 0.18
447 0.17
448 0.13
449 0.12
450 0.13
451 0.14
452 0.16
453 0.18
454 0.19
455 0.2
456 0.19
457 0.2
458 0.26
459 0.31
460 0.3
461 0.3
462 0.33
463 0.31
464 0.33
465 0.38
466 0.32
467 0.26
468 0.26
469 0.24
470 0.23
471 0.24
472 0.26
473 0.21
474 0.2
475 0.2
476 0.2
477 0.22
478 0.2
479 0.23
480 0.23
481 0.28
482 0.32
483 0.4
484 0.48
485 0.48
486 0.56
487 0.61
488 0.66
489 0.71
490 0.77
491 0.8
492 0.78
493 0.85
494 0.8
495 0.77
496 0.68