Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6Q9M3

Protein Details
Accession A0A2Z6Q9M3    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-137MPPIIIKRKIHNENKKSDNKTMKPRRNPIRACKNNHydrophilic
NLS Segment(s)
PositionSequence
117-119KKS
121-128NKTMKPRR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MKTGHRHYTVKALIDTSSRANKISKSLTDRLGKKYGRELSKSDSTEFRKRVKKLEQTVDWIGTYVEKQTGLEAGKELTDSSESSLAEEAYTIEELRESNSDNMPPIIIKRKIHNENKKSDNKTMKPRRNPIRACKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.27
4 0.29
5 0.26
6 0.26
7 0.27
8 0.28
9 0.32
10 0.35
11 0.36
12 0.37
13 0.41
14 0.46
15 0.52
16 0.54
17 0.54
18 0.57
19 0.52
20 0.47
21 0.51
22 0.52
23 0.49
24 0.49
25 0.46
26 0.44
27 0.51
28 0.5
29 0.43
30 0.43
31 0.44
32 0.48
33 0.5
34 0.51
35 0.51
36 0.51
37 0.57
38 0.59
39 0.62
40 0.62
41 0.66
42 0.61
43 0.59
44 0.59
45 0.52
46 0.42
47 0.33
48 0.25
49 0.16
50 0.14
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.05
65 0.06
66 0.06
67 0.07
68 0.09
69 0.09
70 0.09
71 0.1
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.1
85 0.12
86 0.13
87 0.14
88 0.15
89 0.15
90 0.14
91 0.14
92 0.15
93 0.22
94 0.25
95 0.27
96 0.33
97 0.43
98 0.53
99 0.63
100 0.7
101 0.7
102 0.74
103 0.81
104 0.84
105 0.8
106 0.79
107 0.79
108 0.76
109 0.79
110 0.81
111 0.82
112 0.83
113 0.87
114 0.89
115 0.89
116 0.9
117 0.89