Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RRJ5

Protein Details
Accession A0A2Z6RRJ5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-41SLIHHQRAERPHKKGRKGKGNERRRKSGRERKEVVBasic
NLS Segment(s)
PositionSequence
14-39AERPHKKGRKGKGNERRRKSGRERKE
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKVRNCSLIHHQRAERPHKKGRKGKGNERRRKSGRERKEVVEGAIGEERQKKEKNEGYQTSGLEYKLLDFLNELDLRNLPDFLDELDLRLLPAFLDEPDLGILLDFLDKPDLKYCSFLYSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.67
4 0.7
5 0.72
6 0.79
7 0.82
8 0.83
9 0.83
10 0.83
11 0.87
12 0.87
13 0.89
14 0.89
15 0.88
16 0.88
17 0.83
18 0.83
19 0.83
20 0.83
21 0.82
22 0.82
23 0.79
24 0.72
25 0.74
26 0.65
27 0.55
28 0.47
29 0.36
30 0.28
31 0.25
32 0.21
33 0.15
34 0.19
35 0.19
36 0.21
37 0.24
38 0.24
39 0.3
40 0.36
41 0.41
42 0.45
43 0.47
44 0.47
45 0.46
46 0.45
47 0.38
48 0.33
49 0.26
50 0.18
51 0.15
52 0.1
53 0.09
54 0.09
55 0.08
56 0.07
57 0.07
58 0.11
59 0.12
60 0.12
61 0.1
62 0.11
63 0.13
64 0.13
65 0.13
66 0.09
67 0.08
68 0.08
69 0.08
70 0.12
71 0.1
72 0.1
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.05
79 0.06
80 0.06
81 0.05
82 0.09
83 0.09
84 0.09
85 0.09
86 0.1
87 0.09
88 0.08
89 0.08
90 0.05
91 0.06
92 0.05
93 0.06
94 0.1
95 0.11
96 0.13
97 0.19
98 0.22
99 0.22
100 0.25
101 0.26