Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QEF6

Protein Details
Accession A0A2Z6QEF6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-81GYPENRNNIRTRKRTNYRNHPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cysk 9, cyto_nucl 7.333, cyto 3, cyto_pero 2.833, mito 2
Family & Domain DBs
Amino Acid Sequences MALITISNPVNSMEENDTSFTLGGWNVPEERDTPVTIGGWDFSMENLGEKNTGWKKVQRVGYPENRNNIRTRKRTNYRNHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.17
5 0.16
6 0.16
7 0.12
8 0.1
9 0.08
10 0.08
11 0.07
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.12
18 0.13
19 0.13
20 0.12
21 0.12
22 0.12
23 0.11
24 0.1
25 0.07
26 0.06
27 0.06
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.14
38 0.16
39 0.2
40 0.22
41 0.26
42 0.31
43 0.38
44 0.45
45 0.42
46 0.46
47 0.51
48 0.59
49 0.65
50 0.65
51 0.67
52 0.64
53 0.62
54 0.62
55 0.64
56 0.64
57 0.63
58 0.68
59 0.7
60 0.76
61 0.83