Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S090

Protein Details
Accession A0A2Z6S090    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-81PRFCGYAKKKTVCKKCNKEFKGLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 6, pero 3
Family & Domain DBs
Amino Acid Sequences MSAYPGIYGTNTYEEDAAVIEQRRIAATLGPCPKGGNHELRLHYTSGTLFWAFCLGLPRFCGYAKKKTVCKKCNKEFKGLFIPEAGSMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.11
6 0.1
7 0.1
8 0.11
9 0.11
10 0.11
11 0.11
12 0.11
13 0.12
14 0.12
15 0.2
16 0.24
17 0.25
18 0.24
19 0.24
20 0.24
21 0.24
22 0.27
23 0.25
24 0.25
25 0.3
26 0.31
27 0.34
28 0.36
29 0.31
30 0.27
31 0.22
32 0.17
33 0.12
34 0.12
35 0.09
36 0.07
37 0.06
38 0.07
39 0.06
40 0.07
41 0.12
42 0.11
43 0.12
44 0.13
45 0.15
46 0.15
47 0.16
48 0.23
49 0.23
50 0.32
51 0.4
52 0.45
53 0.52
54 0.61
55 0.71
56 0.73
57 0.8
58 0.81
59 0.83
60 0.87
61 0.83
62 0.84
63 0.77
64 0.75
65 0.74
66 0.65
67 0.56
68 0.46
69 0.43