Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SM17

Protein Details
Accession A0A2Z6SM17    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-110RYLLRRRKAATQKSREVEKRLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 4, E.R. 4, golg 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045863  CorA_TM1_TM2  
IPR002523  MgTranspt_CorA/ZnTranspt_ZntB  
Gene Ontology GO:0016020  C:membrane  
GO:0046873  F:metal ion transmembrane transporter activity  
GO:0015693  P:magnesium ion transport  
Pfam View protein in Pfam  
PF01544  CorA  
Amino Acid Sequences MTKITENLVNMIFNLIAYETNENMRIIAIFSVVFLPMTFIAGFFGMNFKTFPQLDYDLSYFWWVTGVSTAIMFVIGTYSIWTKWVARFFRYLLRRRKAATQKSREVEKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.08
5 0.1
6 0.1
7 0.12
8 0.14
9 0.13
10 0.13
11 0.12
12 0.11
13 0.09
14 0.08
15 0.07
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.05
22 0.06
23 0.05
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.05
33 0.06
34 0.06
35 0.06
36 0.09
37 0.09
38 0.1
39 0.12
40 0.14
41 0.14
42 0.16
43 0.16
44 0.13
45 0.13
46 0.14
47 0.1
48 0.08
49 0.08
50 0.05
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.05
66 0.05
67 0.07
68 0.08
69 0.1
70 0.14
71 0.22
72 0.24
73 0.25
74 0.29
75 0.3
76 0.38
77 0.45
78 0.5
79 0.53
80 0.57
81 0.6
82 0.59
83 0.68
84 0.69
85 0.72
86 0.74
87 0.73
88 0.76
89 0.78
90 0.85