Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CRR7

Protein Details
Accession A1CRR7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
211-230GHERKILSRRQRQRRLSIEDBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032466  Metal_Hydrolase  
IPR001130  TatD-like  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
KEGG act:ACLA_030710  -  
Pfam View protein in Pfam  
PF01026  TatD_DNase  
Amino Acid Sequences MSSIADIPQMKATTLTVMATRAEDQDLVFNIAQSTAEDQSNMQSTKEDRVLPCFGWHPWFSHHIIDDQGASSETAAGSKKDHYRKVLTPAPDDEEFLSSLPDPRTLSQLLSETRTRLQKFPSALVGEVGLDRAFRLPQAWTQDEAESRDAQMTPGSREGRKLSPYRVQIDHQKAILKAQLRLAGELGRPVSVHSVQAHGAVFDVFKELWAGHERKILSRRQRQRRLSIEDAHAESDAEDEAVGNSAKRNDTPLPYPPRICMHSYSGPVEQLKQFLNPSNPSDVYFSFSSVINFGTSSSRKVIEVIKALPEDRLLIESDLHTAGQQMDDLLEEVARQVCDLRGWPLRQGVQRLGDNWRRFVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.14
4 0.14
5 0.15
6 0.16
7 0.17
8 0.16
9 0.16
10 0.15
11 0.15
12 0.17
13 0.18
14 0.21
15 0.19
16 0.18
17 0.17
18 0.16
19 0.16
20 0.13
21 0.15
22 0.13
23 0.13
24 0.13
25 0.13
26 0.17
27 0.22
28 0.22
29 0.19
30 0.2
31 0.22
32 0.27
33 0.31
34 0.33
35 0.29
36 0.34
37 0.37
38 0.35
39 0.36
40 0.32
41 0.3
42 0.3
43 0.29
44 0.26
45 0.27
46 0.31
47 0.3
48 0.31
49 0.3
50 0.26
51 0.26
52 0.25
53 0.22
54 0.17
55 0.15
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.09
62 0.09
63 0.09
64 0.11
65 0.16
66 0.25
67 0.32
68 0.37
69 0.41
70 0.47
71 0.51
72 0.57
73 0.58
74 0.54
75 0.5
76 0.48
77 0.47
78 0.41
79 0.37
80 0.3
81 0.25
82 0.21
83 0.17
84 0.15
85 0.1
86 0.14
87 0.14
88 0.15
89 0.15
90 0.15
91 0.19
92 0.19
93 0.19
94 0.17
95 0.21
96 0.2
97 0.22
98 0.23
99 0.21
100 0.25
101 0.31
102 0.32
103 0.3
104 0.32
105 0.34
106 0.35
107 0.35
108 0.35
109 0.29
110 0.27
111 0.24
112 0.21
113 0.16
114 0.13
115 0.12
116 0.07
117 0.05
118 0.05
119 0.06
120 0.06
121 0.05
122 0.06
123 0.07
124 0.11
125 0.17
126 0.19
127 0.2
128 0.21
129 0.23
130 0.23
131 0.24
132 0.23
133 0.17
134 0.15
135 0.15
136 0.14
137 0.12
138 0.13
139 0.11
140 0.11
141 0.17
142 0.19
143 0.18
144 0.2
145 0.24
146 0.25
147 0.3
148 0.31
149 0.3
150 0.34
151 0.38
152 0.4
153 0.39
154 0.38
155 0.42
156 0.45
157 0.42
158 0.37
159 0.35
160 0.3
161 0.29
162 0.29
163 0.22
164 0.17
165 0.17
166 0.2
167 0.18
168 0.18
169 0.17
170 0.16
171 0.14
172 0.14
173 0.12
174 0.08
175 0.08
176 0.08
177 0.1
178 0.09
179 0.1
180 0.09
181 0.11
182 0.11
183 0.12
184 0.12
185 0.09
186 0.09
187 0.07
188 0.07
189 0.05
190 0.06
191 0.05
192 0.05
193 0.05
194 0.05
195 0.07
196 0.13
197 0.14
198 0.14
199 0.18
200 0.19
201 0.23
202 0.28
203 0.34
204 0.38
205 0.47
206 0.56
207 0.63
208 0.73
209 0.76
210 0.8
211 0.81
212 0.8
213 0.75
214 0.71
215 0.63
216 0.57
217 0.51
218 0.42
219 0.34
220 0.25
221 0.19
222 0.14
223 0.1
224 0.06
225 0.05
226 0.04
227 0.04
228 0.05
229 0.05
230 0.05
231 0.06
232 0.09
233 0.1
234 0.1
235 0.15
236 0.17
237 0.21
238 0.24
239 0.32
240 0.38
241 0.41
242 0.42
243 0.41
244 0.42
245 0.42
246 0.41
247 0.35
248 0.33
249 0.34
250 0.36
251 0.36
252 0.33
253 0.33
254 0.31
255 0.31
256 0.25
257 0.23
258 0.21
259 0.2
260 0.21
261 0.22
262 0.27
263 0.28
264 0.29
265 0.32
266 0.32
267 0.31
268 0.32
269 0.28
270 0.27
271 0.24
272 0.22
273 0.18
274 0.18
275 0.17
276 0.14
277 0.14
278 0.1
279 0.1
280 0.09
281 0.15
282 0.15
283 0.17
284 0.19
285 0.2
286 0.2
287 0.22
288 0.26
289 0.25
290 0.28
291 0.28
292 0.3
293 0.3
294 0.3
295 0.29
296 0.25
297 0.21
298 0.17
299 0.16
300 0.13
301 0.12
302 0.13
303 0.13
304 0.15
305 0.14
306 0.13
307 0.12
308 0.11
309 0.11
310 0.1
311 0.1
312 0.08
313 0.07
314 0.08
315 0.08
316 0.07
317 0.07
318 0.06
319 0.08
320 0.1
321 0.1
322 0.09
323 0.1
324 0.11
325 0.13
326 0.15
327 0.2
328 0.26
329 0.28
330 0.32
331 0.37
332 0.43
333 0.46
334 0.51
335 0.5
336 0.5
337 0.51
338 0.5
339 0.53
340 0.56
341 0.54
342 0.54