Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R3Y4

Protein Details
Accession A0A2Z6R3Y4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-67FLTKSQKRNTKEKACKEKKKLQLQTPSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYQSNISINVDVINKDLKGLLDDKSGIILLRSNTPLPVMFLTKSQKRNTKEKACKEKKKLQLQTPSGLNEYIVLTFSKKSPEYTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.12
5 0.13
6 0.14
7 0.14
8 0.13
9 0.14
10 0.14
11 0.13
12 0.13
13 0.11
14 0.09
15 0.1
16 0.09
17 0.12
18 0.13
19 0.13
20 0.13
21 0.13
22 0.13
23 0.12
24 0.12
25 0.11
26 0.1
27 0.13
28 0.18
29 0.23
30 0.29
31 0.32
32 0.39
33 0.42
34 0.51
35 0.57
36 0.63
37 0.67
38 0.72
39 0.78
40 0.81
41 0.87
42 0.86
43 0.87
44 0.85
45 0.86
46 0.85
47 0.82
48 0.81
49 0.76
50 0.73
51 0.67
52 0.6
53 0.5
54 0.42
55 0.33
56 0.24
57 0.2
58 0.15
59 0.12
60 0.1
61 0.1
62 0.11
63 0.13
64 0.18
65 0.18
66 0.22