Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QMS1

Protein Details
Accession A0A2Z6QMS1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-39QLQKKKYTWESLKTKKERKETEKHydrophilic
94-124LKVHMDSMKKKERKKEKLKAKKIQKAKATIABasic
NLS Segment(s)
PositionSequence
102-121KKKERKKEKLKAKKIQKAKA
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007110  Ig-like_dom  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
PROSITE View protein in PROSITE  
PS50835  IG_LIKE  
Amino Acid Sequences MTCFLHNLLNSLKKQTQLQKKKYTWESLKTKKERKETEKSNVLDKQSVEGELQKEVDSKEYSCLVRAVYGNSKISTLVSPSDTDKFITGYSNILKVHMDSMKKKERKKEKLKAKKIQKAKATIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.54
4 0.58
5 0.66
6 0.7
7 0.71
8 0.78
9 0.77
10 0.78
11 0.74
12 0.73
13 0.74
14 0.73
15 0.79
16 0.8
17 0.81
18 0.79
19 0.82
20 0.82
21 0.79
22 0.8
23 0.78
24 0.77
25 0.77
26 0.71
27 0.68
28 0.62
29 0.56
30 0.48
31 0.4
32 0.33
33 0.25
34 0.25
35 0.18
36 0.16
37 0.15
38 0.13
39 0.14
40 0.11
41 0.12
42 0.11
43 0.13
44 0.11
45 0.11
46 0.12
47 0.14
48 0.14
49 0.13
50 0.14
51 0.11
52 0.12
53 0.12
54 0.13
55 0.14
56 0.17
57 0.18
58 0.17
59 0.18
60 0.16
61 0.16
62 0.14
63 0.11
64 0.1
65 0.1
66 0.11
67 0.13
68 0.14
69 0.14
70 0.14
71 0.14
72 0.13
73 0.12
74 0.13
75 0.11
76 0.12
77 0.13
78 0.16
79 0.16
80 0.16
81 0.16
82 0.14
83 0.19
84 0.2
85 0.24
86 0.25
87 0.34
88 0.44
89 0.51
90 0.56
91 0.62
92 0.69
93 0.75
94 0.81
95 0.83
96 0.84
97 0.89
98 0.93
99 0.94
100 0.94
101 0.93
102 0.91
103 0.9
104 0.87