Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M4X6

Protein Details
Accession E2M4X6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-115VGFSRRGIFKNKKAVRKKLRBasic
NLS Segment(s)
PositionSequence
101-115RGIFKNKKAVRKKLR
Subcellular Location(s) cyto 19.5, cyto_nucl 10.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
KEGG mpr:MPER_15452  -  
Amino Acid Sequences MLPPGARFDIAVIDEIQMIGDSSRGYAWTNAVLGICAPEIHLCGEETAVPVIQALLKGNTNDTLEIRRYERLSPLTVSTESLQGELANVKKGDCIVGFSRRGIFKNKKAVRKKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.07
5 0.07
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.08
13 0.08
14 0.09
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.08
21 0.08
22 0.07
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.09
47 0.09
48 0.09
49 0.09
50 0.11
51 0.12
52 0.14
53 0.15
54 0.16
55 0.18
56 0.18
57 0.22
58 0.22
59 0.22
60 0.22
61 0.22
62 0.22
63 0.21
64 0.21
65 0.18
66 0.18
67 0.16
68 0.15
69 0.13
70 0.1
71 0.1
72 0.11
73 0.12
74 0.13
75 0.13
76 0.13
77 0.14
78 0.14
79 0.16
80 0.13
81 0.16
82 0.17
83 0.24
84 0.26
85 0.26
86 0.31
87 0.33
88 0.35
89 0.4
90 0.45
91 0.47
92 0.56
93 0.63
94 0.69
95 0.75