Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R7D7

Protein Details
Accession A0A2Z6R7D7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTRKNKSTKSWSKTKAKRNELRYKSTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 14.333, cyto_nucl 11.166, mito 6
Family & Domain DBs
Amino Acid Sequences MTRKNKSTKSWSKTKAKRNELRYKSTFWSKMYDIANKKRIGLSLELANSKRMIEDLNKKLKEVTNNLNEWKELYYHEVTAAEKWGYKFYIESAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.86
5 0.86
6 0.87
7 0.83
8 0.83
9 0.76
10 0.71
11 0.65
12 0.66
13 0.59
14 0.5
15 0.48
16 0.4
17 0.42
18 0.4
19 0.42
20 0.41
21 0.45
22 0.5
23 0.45
24 0.45
25 0.4
26 0.38
27 0.32
28 0.27
29 0.21
30 0.18
31 0.19
32 0.2
33 0.2
34 0.19
35 0.17
36 0.15
37 0.13
38 0.09
39 0.09
40 0.12
41 0.21
42 0.28
43 0.38
44 0.38
45 0.38
46 0.4
47 0.42
48 0.42
49 0.39
50 0.4
51 0.37
52 0.4
53 0.43
54 0.41
55 0.38
56 0.34
57 0.29
58 0.22
59 0.16
60 0.18
61 0.17
62 0.16
63 0.18
64 0.18
65 0.18
66 0.18
67 0.2
68 0.15
69 0.16
70 0.17
71 0.19
72 0.18
73 0.18
74 0.18
75 0.19