Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CHU9

Protein Details
Accession A1CHU9   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
354-376FARMPTSIYRRKRPPFSIPSTVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010989  SNARE  
IPR045242  Syntaxin  
IPR006012  Syntaxin/epimorphin_CS  
IPR000727  T_SNARE_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0005484  F:SNAP receptor activity  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
KEGG act:ACLA_049260  -  
Pfam View protein in Pfam  
PF05739  SNARE  
PROSITE View protein in PROSITE  
PS00914  SYNTAXIN  
PS50192  T_SNARE  
CDD cd15845  SNARE_syntaxin16  
Amino Acid Sequences MWRDRTNLYISYRQSFAHHPAKKPRYIGPSNGFTDTSSQPEESRRLISETGGLEDDGDAIIEMDLLPPRWVDVQDEVTELLADIAQKSAQLDKLHQKHLLPGFGDEDVRKQEEHVIERLTQDITRGFHECQKAVQRIEVMVHDAKQQGGVSAGDETMAKNIQISLASRVQEASARFRKKQSTYLKKLRGLEGVAAPFERAPTPQNPYMDPSLMESDADKSFSQSTLMRTSQRLAGQHDEAIEHREREINDIAKSIIELSDIFRELQAMVIDQGTMLDRIDYNIERMGTEVKAADKELKVATNYQRRTTKRKVLLLLVILIAGMIIILLVKPKRHSSPAPAPPTPPPVEQPPSVFARMPTSIYRRKRPPFSIPSTVDKFFEPDIHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.42
4 0.44
5 0.47
6 0.51
7 0.61
8 0.68
9 0.7
10 0.69
11 0.68
12 0.68
13 0.67
14 0.68
15 0.65
16 0.64
17 0.61
18 0.6
19 0.52
20 0.43
21 0.42
22 0.34
23 0.31
24 0.26
25 0.24
26 0.24
27 0.28
28 0.32
29 0.29
30 0.31
31 0.29
32 0.29
33 0.29
34 0.28
35 0.27
36 0.24
37 0.24
38 0.21
39 0.19
40 0.15
41 0.15
42 0.14
43 0.09
44 0.08
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.11
57 0.12
58 0.13
59 0.16
60 0.19
61 0.19
62 0.21
63 0.2
64 0.18
65 0.17
66 0.14
67 0.1
68 0.07
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.1
76 0.14
77 0.15
78 0.2
79 0.29
80 0.35
81 0.39
82 0.41
83 0.39
84 0.42
85 0.45
86 0.43
87 0.34
88 0.29
89 0.27
90 0.25
91 0.26
92 0.19
93 0.18
94 0.17
95 0.18
96 0.16
97 0.15
98 0.2
99 0.23
100 0.26
101 0.26
102 0.25
103 0.25
104 0.25
105 0.26
106 0.21
107 0.17
108 0.15
109 0.15
110 0.14
111 0.15
112 0.17
113 0.17
114 0.21
115 0.24
116 0.23
117 0.25
118 0.32
119 0.34
120 0.32
121 0.32
122 0.28
123 0.26
124 0.27
125 0.23
126 0.19
127 0.15
128 0.15
129 0.16
130 0.15
131 0.14
132 0.14
133 0.13
134 0.1
135 0.1
136 0.09
137 0.07
138 0.07
139 0.07
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.06
149 0.06
150 0.07
151 0.1
152 0.13
153 0.14
154 0.14
155 0.14
156 0.14
157 0.16
158 0.16
159 0.2
160 0.26
161 0.29
162 0.31
163 0.35
164 0.41
165 0.41
166 0.49
167 0.52
168 0.54
169 0.6
170 0.68
171 0.72
172 0.7
173 0.7
174 0.62
175 0.54
176 0.43
177 0.36
178 0.28
179 0.21
180 0.16
181 0.14
182 0.12
183 0.09
184 0.09
185 0.08
186 0.06
187 0.08
188 0.11
189 0.16
190 0.2
191 0.21
192 0.21
193 0.24
194 0.25
195 0.22
196 0.2
197 0.17
198 0.15
199 0.14
200 0.13
201 0.1
202 0.11
203 0.11
204 0.13
205 0.1
206 0.1
207 0.11
208 0.11
209 0.12
210 0.11
211 0.14
212 0.17
213 0.2
214 0.21
215 0.21
216 0.22
217 0.25
218 0.26
219 0.25
220 0.24
221 0.25
222 0.24
223 0.24
224 0.23
225 0.2
226 0.18
227 0.2
228 0.18
229 0.14
230 0.13
231 0.16
232 0.16
233 0.19
234 0.23
235 0.21
236 0.2
237 0.21
238 0.2
239 0.17
240 0.17
241 0.13
242 0.09
243 0.06
244 0.06
245 0.07
246 0.09
247 0.1
248 0.1
249 0.1
250 0.1
251 0.1
252 0.11
253 0.09
254 0.07
255 0.07
256 0.07
257 0.07
258 0.06
259 0.07
260 0.06
261 0.06
262 0.05
263 0.05
264 0.05
265 0.06
266 0.1
267 0.1
268 0.11
269 0.13
270 0.13
271 0.12
272 0.13
273 0.15
274 0.12
275 0.12
276 0.12
277 0.11
278 0.12
279 0.13
280 0.17
281 0.15
282 0.18
283 0.19
284 0.2
285 0.2
286 0.25
287 0.33
288 0.37
289 0.4
290 0.45
291 0.52
292 0.55
293 0.63
294 0.67
295 0.68
296 0.67
297 0.72
298 0.68
299 0.65
300 0.65
301 0.58
302 0.49
303 0.39
304 0.3
305 0.22
306 0.17
307 0.11
308 0.06
309 0.04
310 0.02
311 0.02
312 0.02
313 0.02
314 0.07
315 0.09
316 0.12
317 0.15
318 0.21
319 0.26
320 0.33
321 0.38
322 0.43
323 0.53
324 0.6
325 0.65
326 0.62
327 0.61
328 0.6
329 0.62
330 0.57
331 0.48
332 0.43
333 0.42
334 0.45
335 0.44
336 0.43
337 0.4
338 0.41
339 0.41
340 0.38
341 0.31
342 0.32
343 0.31
344 0.31
345 0.33
346 0.37
347 0.44
348 0.51
349 0.6
350 0.64
351 0.72
352 0.78
353 0.79
354 0.81
355 0.82
356 0.82
357 0.82
358 0.77
359 0.76
360 0.72
361 0.67
362 0.57
363 0.48
364 0.43
365 0.34