Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S4C5

Protein Details
Accession A0A2Z6S4C5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-55QKMNAKKKAYKEKKKILQLQTHydrophilic
NLS Segment(s)
PositionSequence
40-49KKKAYKEKKK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 1, plas 1, pero 1, cysk 1
Family & Domain DBs
Amino Acid Sequences MSINVDEIDEDLKGLLDDESSATSPRNNTPLPITQKMNAKKKAYKEKKKILQLQTPSELDEQVVPTFSAKSPEYIPFRPSGSRLLLIKVCFFLLSHLLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.06
6 0.08
7 0.09
8 0.09
9 0.09
10 0.11
11 0.14
12 0.16
13 0.21
14 0.19
15 0.2
16 0.23
17 0.31
18 0.36
19 0.38
20 0.38
21 0.36
22 0.44
23 0.51
24 0.56
25 0.55
26 0.54
27 0.54
28 0.61
29 0.68
30 0.71
31 0.73
32 0.74
33 0.77
34 0.79
35 0.83
36 0.83
37 0.79
38 0.75
39 0.69
40 0.64
41 0.58
42 0.5
43 0.42
44 0.34
45 0.27
46 0.2
47 0.16
48 0.13
49 0.09
50 0.09
51 0.08
52 0.08
53 0.09
54 0.09
55 0.12
56 0.11
57 0.13
58 0.15
59 0.22
60 0.27
61 0.28
62 0.3
63 0.28
64 0.3
65 0.31
66 0.3
67 0.28
68 0.26
69 0.28
70 0.27
71 0.3
72 0.31
73 0.31
74 0.31
75 0.27
76 0.23
77 0.19
78 0.18
79 0.16
80 0.16