Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R629

Protein Details
Accession A0A2Z6R629    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-52EYTNTKIKKKKPVKISCRVVSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, cyto 14.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MDYFFSDERLDEDADEELHAIRVGDVFLIDKEYTNTKIKKKKPVKISCRVVSIGNTGRLKVALLRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.08
5 0.08
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.13
21 0.18
22 0.23
23 0.28
24 0.37
25 0.44
26 0.54
27 0.61
28 0.66
29 0.72
30 0.78
31 0.8
32 0.82
33 0.85
34 0.78
35 0.73
36 0.66
37 0.57
38 0.48
39 0.45
40 0.4
41 0.38
42 0.35
43 0.31
44 0.3
45 0.28
46 0.27
47 0.24