Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QHQ9

Protein Details
Accession A0A2Z6QHQ9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
62-89MKNVKKCENLAHKFKRRNLFLRKFQYSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRGLEHRSLDRRYQLLLQSYDRTCWVERHGAMRKQFTGRSVVHFFGSPFVAGPEYFVINIIMKNVKKCENLAHKFKRRNLFLRKFQYSIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.4
4 0.38
5 0.39
6 0.38
7 0.36
8 0.33
9 0.31
10 0.26
11 0.24
12 0.24
13 0.25
14 0.25
15 0.32
16 0.39
17 0.41
18 0.44
19 0.46
20 0.45
21 0.42
22 0.42
23 0.35
24 0.32
25 0.28
26 0.3
27 0.29
28 0.27
29 0.23
30 0.23
31 0.21
32 0.17
33 0.16
34 0.1
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.13
49 0.14
50 0.17
51 0.2
52 0.24
53 0.25
54 0.27
55 0.34
56 0.4
57 0.47
58 0.55
59 0.62
60 0.67
61 0.74
62 0.8
63 0.81
64 0.78
65 0.8
66 0.8
67 0.8
68 0.81
69 0.82
70 0.81