Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R750

Protein Details
Accession A0A2Z6R750    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-34DDLKERKKLRITKKLKDQGLBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 10.5, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MEYNVLIPKNYSTFDDLKERKKLRITKKLKDQGLDENHFISLLTFVILFNDVASRKFYYIYISVTPGTQFIIKGMIQVYMASKFLEETI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.35
3 0.38
4 0.42
5 0.5
6 0.51
7 0.51
8 0.57
9 0.63
10 0.63
11 0.69
12 0.71
13 0.71
14 0.79
15 0.83
16 0.77
17 0.71
18 0.63
19 0.61
20 0.6
21 0.54
22 0.43
23 0.35
24 0.31
25 0.28
26 0.25
27 0.16
28 0.09
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.1
41 0.1
42 0.1
43 0.11
44 0.12
45 0.13
46 0.15
47 0.17
48 0.16
49 0.17
50 0.17
51 0.17
52 0.17
53 0.14
54 0.13
55 0.11
56 0.1
57 0.08
58 0.11
59 0.1
60 0.12
61 0.12
62 0.12
63 0.11
64 0.12
65 0.13
66 0.12
67 0.13
68 0.11
69 0.11