Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SGA9

Protein Details
Accession A0A2Z6SGA9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-82ARRNRVDRRRYEYRERRRSRSHHCHKRRRSYSPYLRHRHRHBasic
NLS Segment(s)
PositionSequence
41-82AARRNRVDRRRYEYRERRRSRSHHCHKRRRSYSPYLRHRHRH
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MAWLGSAHAKLYPTRTPTFHNERFHDELSDEFWLAETPVRAARRNRVDRRRYEYRERRRSRSHHCHKRRRSYSPYLRHRHRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.43
5 0.5
6 0.53
7 0.54
8 0.52
9 0.56
10 0.58
11 0.54
12 0.47
13 0.37
14 0.3
15 0.25
16 0.23
17 0.16
18 0.11
19 0.1
20 0.09
21 0.08
22 0.09
23 0.06
24 0.06
25 0.1
26 0.12
27 0.16
28 0.17
29 0.25
30 0.34
31 0.44
32 0.53
33 0.59
34 0.65
35 0.69
36 0.76
37 0.79
38 0.76
39 0.77
40 0.78
41 0.79
42 0.83
43 0.82
44 0.82
45 0.81
46 0.83
47 0.83
48 0.83
49 0.83
50 0.84
51 0.88
52 0.91
53 0.92
54 0.95
55 0.93
56 0.91
57 0.88
58 0.88
59 0.88
60 0.88
61 0.88
62 0.87