Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RAA5

Protein Details
Accession A0A2Z6RAA5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-45DKAYRRKAIKFHPDKNRDNVEBasic
NLS Segment(s)
PositionSequence
76-95AKIESKKRFEKLDAKRKALK
128-135ARRRRERE
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MTEVKDLDLYELLGVNYNSTKEEIDKAYRRKAIKFHPDKNRDNVEAATKFFHLISDAYKTLTDPQKKLEYDKIYKAKIESKKRFEKLDAKRKALKEELEEREKAVKQSKVYTQESSEAKIERIKEETARRRREREEKLRLSADQRSKASTQYRTNLTSPSSKNSSKIPEPSKPVFGYRQGSDFESIVLNKMTEYEKSEKEKQQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.13
5 0.14
6 0.14
7 0.15
8 0.14
9 0.18
10 0.21
11 0.29
12 0.37
13 0.42
14 0.49
15 0.54
16 0.56
17 0.56
18 0.6
19 0.61
20 0.64
21 0.68
22 0.69
23 0.74
24 0.8
25 0.81
26 0.81
27 0.77
28 0.68
29 0.61
30 0.53
31 0.5
32 0.42
33 0.38
34 0.31
35 0.25
36 0.23
37 0.2
38 0.18
39 0.12
40 0.11
41 0.12
42 0.14
43 0.14
44 0.14
45 0.14
46 0.15
47 0.2
48 0.27
49 0.31
50 0.27
51 0.32
52 0.38
53 0.39
54 0.42
55 0.44
56 0.44
57 0.43
58 0.51
59 0.52
60 0.46
61 0.47
62 0.45
63 0.46
64 0.47
65 0.53
66 0.53
67 0.56
68 0.64
69 0.66
70 0.66
71 0.63
72 0.65
73 0.64
74 0.66
75 0.64
76 0.6
77 0.63
78 0.61
79 0.6
80 0.54
81 0.45
82 0.4
83 0.42
84 0.42
85 0.4
86 0.38
87 0.35
88 0.35
89 0.34
90 0.3
91 0.27
92 0.25
93 0.22
94 0.26
95 0.3
96 0.33
97 0.35
98 0.34
99 0.3
100 0.33
101 0.32
102 0.31
103 0.28
104 0.21
105 0.19
106 0.21
107 0.2
108 0.16
109 0.18
110 0.17
111 0.21
112 0.29
113 0.39
114 0.46
115 0.55
116 0.58
117 0.61
118 0.68
119 0.72
120 0.74
121 0.74
122 0.76
123 0.72
124 0.72
125 0.69
126 0.63
127 0.57
128 0.55
129 0.51
130 0.47
131 0.42
132 0.4
133 0.38
134 0.42
135 0.45
136 0.44
137 0.43
138 0.42
139 0.46
140 0.46
141 0.47
142 0.44
143 0.4
144 0.4
145 0.36
146 0.37
147 0.38
148 0.36
149 0.37
150 0.4
151 0.44
152 0.42
153 0.49
154 0.49
155 0.5
156 0.56
157 0.58
158 0.59
159 0.54
160 0.52
161 0.48
162 0.48
163 0.46
164 0.41
165 0.4
166 0.36
167 0.36
168 0.34
169 0.29
170 0.23
171 0.21
172 0.19
173 0.18
174 0.17
175 0.14
176 0.12
177 0.14
178 0.15
179 0.14
180 0.2
181 0.24
182 0.3
183 0.38
184 0.47