Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R1V5

Protein Details
Accession A0A2Z6R1V5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPLTKSQKRSAKKKARKEKQKLQLQIPSHydrophilic
NLS Segment(s)
PositionSequence
7-20QKRSAKKKARKEKQ
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MPLTKSQKRSAKKKARKEKQKLQLQIPSELDEQVVPTFSTESPEYTPSKPSGSRMVTFNQSLLSPPFHTLQAAVEARF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.94
4 0.94
5 0.93
6 0.92
7 0.91
8 0.87
9 0.83
10 0.79
11 0.7
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.24
18 0.18
19 0.16
20 0.1
21 0.1
22 0.06
23 0.06
24 0.07
25 0.06
26 0.09
27 0.09
28 0.1
29 0.11
30 0.14
31 0.16
32 0.16
33 0.19
34 0.18
35 0.21
36 0.2
37 0.21
38 0.27
39 0.28
40 0.29
41 0.29
42 0.31
43 0.32
44 0.31
45 0.29
46 0.22
47 0.19
48 0.19
49 0.18
50 0.18
51 0.15
52 0.17
53 0.19
54 0.18
55 0.18
56 0.17
57 0.16
58 0.21