Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QSY5

Protein Details
Accession A0A2Z6QSY5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
170-189AGACKGGKTNPKRRRALNYYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR036861  Endochitinase-like_sf  
IPR018466  Kre9/Knh1-like_N  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF10342  Kre9_KNH  
PROSITE View protein in PROSITE  
PS50941  CHIT_BIND_I_2  
Amino Acid Sequences MAKSLLALLFIALSYTSYANAGYNVVTPTTGTILYAGYPANITWTMDNTTPNDPLVDVVLNNGPPESLNVVSTICSGVDPKVGVCNFNVPANIASGIDYAITVGKKVENLAYGSYFTIKGTGDLPPNNGCPNMGGHVCASADLACCGPDGYCGKGTDFCGAGCQQQFSLAGACKGGKTNPKRRRALNYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.08
6 0.08
7 0.09
8 0.09
9 0.08
10 0.1
11 0.1
12 0.1
13 0.1
14 0.09
15 0.1
16 0.11
17 0.1
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.08
24 0.06
25 0.07
26 0.07
27 0.09
28 0.09
29 0.1
30 0.09
31 0.11
32 0.13
33 0.14
34 0.16
35 0.16
36 0.19
37 0.19
38 0.18
39 0.16
40 0.14
41 0.13
42 0.12
43 0.1
44 0.07
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.07
51 0.07
52 0.08
53 0.09
54 0.08
55 0.08
56 0.09
57 0.09
58 0.09
59 0.1
60 0.09
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.06
68 0.11
69 0.11
70 0.12
71 0.11
72 0.14
73 0.14
74 0.15
75 0.15
76 0.11
77 0.11
78 0.11
79 0.11
80 0.08
81 0.07
82 0.06
83 0.06
84 0.05
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.07
96 0.08
97 0.09
98 0.1
99 0.1
100 0.1
101 0.11
102 0.1
103 0.08
104 0.09
105 0.08
106 0.08
107 0.08
108 0.11
109 0.14
110 0.14
111 0.17
112 0.18
113 0.2
114 0.2
115 0.19
116 0.16
117 0.13
118 0.14
119 0.15
120 0.13
121 0.12
122 0.11
123 0.12
124 0.12
125 0.11
126 0.1
127 0.08
128 0.08
129 0.08
130 0.08
131 0.07
132 0.07
133 0.07
134 0.06
135 0.1
136 0.12
137 0.14
138 0.17
139 0.18
140 0.19
141 0.22
142 0.24
143 0.23
144 0.21
145 0.18
146 0.19
147 0.19
148 0.22
149 0.2
150 0.2
151 0.17
152 0.18
153 0.19
154 0.17
155 0.2
156 0.17
157 0.17
158 0.17
159 0.18
160 0.17
161 0.18
162 0.23
163 0.28
164 0.37
165 0.47
166 0.55
167 0.65
168 0.71
169 0.77