Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RLY1

Protein Details
Accession A0A2Z6RLY1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-81DGFTKVLNRKSQRKENKQKRATPIIDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSGPSQGTRSQTRNKVPQHINEEKMDLDNIEKSSISSENDFQRIHKTFNIGENNDGFTKVLNRKSQRKENKQKRATPIIDNRQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.69
4 0.71
5 0.71
6 0.7
7 0.64
8 0.57
9 0.52
10 0.43
11 0.38
12 0.3
13 0.21
14 0.15
15 0.14
16 0.13
17 0.12
18 0.11
19 0.1
20 0.12
21 0.13
22 0.13
23 0.12
24 0.14
25 0.16
26 0.19
27 0.19
28 0.18
29 0.23
30 0.24
31 0.24
32 0.22
33 0.22
34 0.21
35 0.28
36 0.33
37 0.27
38 0.28
39 0.27
40 0.28
41 0.25
42 0.24
43 0.17
44 0.11
45 0.17
46 0.21
47 0.26
48 0.32
49 0.39
50 0.48
51 0.57
52 0.68
53 0.73
54 0.78
55 0.84
56 0.87
57 0.91
58 0.91
59 0.9
60 0.89
61 0.88
62 0.81
63 0.8
64 0.79