Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QPK0

Protein Details
Accession A0A2Z6QPK0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-74LYNLKKFIRTLKQKIKRKGNKRKLLTLLQRAKHydrophilic
NLS Segment(s)
PositionSequence
47-78KKFIRTLKQKIKRKGNKRKLLTLLQRAKASRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MYHLRNYSNDSVATIGSVISNATEEFDEVLKQIEIQEDKKQKLYNLKKFIRTLKQKIKRKGNKRKLLTLLQRAKASRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.09
3 0.07
4 0.06
5 0.05
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.06
16 0.08
17 0.06
18 0.06
19 0.07
20 0.09
21 0.1
22 0.12
23 0.2
24 0.24
25 0.25
26 0.28
27 0.29
28 0.29
29 0.38
30 0.46
31 0.48
32 0.53
33 0.57
34 0.6
35 0.63
36 0.68
37 0.67
38 0.66
39 0.67
40 0.68
41 0.74
42 0.77
43 0.83
44 0.87
45 0.87
46 0.89
47 0.9
48 0.9
49 0.91
50 0.88
51 0.88
52 0.84
53 0.84
54 0.82
55 0.82
56 0.8
57 0.75
58 0.74