Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6Q0Z6

Protein Details
Accession A0A2Z6Q0Z6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-47YTENTKKYRISRIPRRARNHKKIETSTKNRHydrophilic
NLS Segment(s)
PositionSequence
26-41RISRIPRRARNHKKIE
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences EKYKQDLDFGGEDYDLDYTENTKKYRISRIPRRARNHKKIETSTKNRRHIYVSLELPHRQGKRPRLFRINEYGDLVIIVDDRNMEHVFGPVIKKLVKRIRCVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.1
3 0.08
4 0.07
5 0.08
6 0.13
7 0.18
8 0.18
9 0.2
10 0.25
11 0.29
12 0.39
13 0.46
14 0.52
15 0.59
16 0.69
17 0.77
18 0.82
19 0.87
20 0.88
21 0.9
22 0.9
23 0.89
24 0.86
25 0.83
26 0.81
27 0.82
28 0.8
29 0.79
30 0.79
31 0.79
32 0.79
33 0.73
34 0.67
35 0.6
36 0.52
37 0.48
38 0.43
39 0.36
40 0.31
41 0.33
42 0.32
43 0.3
44 0.33
45 0.29
46 0.29
47 0.34
48 0.4
49 0.48
50 0.56
51 0.61
52 0.64
53 0.66
54 0.64
55 0.67
56 0.62
57 0.54
58 0.47
59 0.4
60 0.31
61 0.28
62 0.23
63 0.13
64 0.08
65 0.06
66 0.04
67 0.04
68 0.05
69 0.08
70 0.08
71 0.09
72 0.09
73 0.1
74 0.11
75 0.13
76 0.15
77 0.14
78 0.17
79 0.2
80 0.22
81 0.31
82 0.39
83 0.43
84 0.5