Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SIV2

Protein Details
Accession A0A2Z6SIV2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-32TEFKWYRTSGRPPKKNSGKNSHydrophilic
57-82GSSCSVKRNPPSKNKKQKTANSTLDKHydrophilic
NLS Segment(s)
PositionSequence
23-30PPKKNSGK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MVLESPFVYERTEFKWYRTSGRPPKKNSGKNSARSSQKCSKKDSGAQGSPKSSSKPGSSCSVKRNPPSKNKKQKTANSTLDKADILKLVLALLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.36
4 0.41
5 0.46
6 0.52
7 0.55
8 0.66
9 0.71
10 0.7
11 0.79
12 0.82
13 0.83
14 0.79
15 0.79
16 0.77
17 0.77
18 0.77
19 0.73
20 0.72
21 0.66
22 0.68
23 0.66
24 0.67
25 0.61
26 0.61
27 0.6
28 0.55
29 0.58
30 0.59
31 0.57
32 0.53
33 0.54
34 0.5
35 0.45
36 0.42
37 0.37
38 0.31
39 0.25
40 0.22
41 0.21
42 0.21
43 0.22
44 0.27
45 0.32
46 0.34
47 0.4
48 0.46
49 0.49
50 0.55
51 0.6
52 0.61
53 0.67
54 0.73
55 0.77
56 0.8
57 0.82
58 0.84
59 0.86
60 0.87
61 0.86
62 0.85
63 0.84
64 0.8
65 0.75
66 0.67
67 0.59
68 0.5
69 0.41
70 0.33
71 0.25
72 0.17
73 0.15
74 0.13