Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RH94

Protein Details
Accession A0A2Z6RH94    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
202-231SLKARDVKPVYRPKPRPKPKSKPQYCDDWEHydrophilic
NLS Segment(s)
PositionSequence
212-223YRPKPRPKPKSK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 7.5, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MEFTNDPLNHNVVGGAAGGGVAIAGGAGVGQPYVIPAYPCHVLIKMRNDFPTQQNARRQLRFGNLFQENMPVRDFYDKVRRSAELLGYGNDVLVNQFLRGLNDDCSIEAERIGAERDIEELVSLLERVEKRKAELRIGRERQENIRYQRDRQIILEQLPPVSQEPVILKPVQHHAVTQGEMNHLLQQQAKTFQSQIRQLQDSLKARDVKPVYRPKPRPKPKSKPQYCDDWELYAQDDIPDEAFNPPDEDGDDDRHLQYTVYLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.05
4 0.05
5 0.04
6 0.04
7 0.03
8 0.02
9 0.02
10 0.02
11 0.01
12 0.01
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.03
20 0.05
21 0.06
22 0.07
23 0.07
24 0.11
25 0.13
26 0.14
27 0.15
28 0.16
29 0.19
30 0.25
31 0.34
32 0.36
33 0.39
34 0.41
35 0.43
36 0.45
37 0.45
38 0.49
39 0.47
40 0.48
41 0.52
42 0.59
43 0.63
44 0.62
45 0.6
46 0.54
47 0.56
48 0.54
49 0.48
50 0.46
51 0.4
52 0.39
53 0.37
54 0.39
55 0.31
56 0.27
57 0.26
58 0.18
59 0.17
60 0.2
61 0.2
62 0.18
63 0.28
64 0.29
65 0.31
66 0.33
67 0.33
68 0.32
69 0.35
70 0.32
71 0.27
72 0.25
73 0.23
74 0.22
75 0.21
76 0.18
77 0.14
78 0.12
79 0.06
80 0.06
81 0.06
82 0.04
83 0.06
84 0.07
85 0.07
86 0.1
87 0.11
88 0.12
89 0.13
90 0.13
91 0.12
92 0.14
93 0.14
94 0.12
95 0.1
96 0.09
97 0.07
98 0.08
99 0.08
100 0.06
101 0.05
102 0.05
103 0.06
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.06
113 0.07
114 0.1
115 0.13
116 0.14
117 0.16
118 0.22
119 0.24
120 0.28
121 0.33
122 0.37
123 0.44
124 0.48
125 0.5
126 0.47
127 0.47
128 0.45
129 0.46
130 0.45
131 0.41
132 0.47
133 0.45
134 0.45
135 0.51
136 0.49
137 0.45
138 0.4
139 0.38
140 0.32
141 0.32
142 0.32
143 0.24
144 0.21
145 0.2
146 0.19
147 0.15
148 0.13
149 0.1
150 0.09
151 0.1
152 0.12
153 0.15
154 0.14
155 0.14
156 0.15
157 0.2
158 0.22
159 0.2
160 0.18
161 0.19
162 0.21
163 0.21
164 0.21
165 0.17
166 0.15
167 0.15
168 0.16
169 0.15
170 0.14
171 0.14
172 0.15
173 0.15
174 0.16
175 0.2
176 0.2
177 0.19
178 0.21
179 0.23
180 0.26
181 0.32
182 0.36
183 0.37
184 0.39
185 0.38
186 0.4
187 0.45
188 0.45
189 0.42
190 0.43
191 0.42
192 0.4
193 0.48
194 0.47
195 0.43
196 0.47
197 0.54
198 0.56
199 0.62
200 0.71
201 0.74
202 0.82
203 0.88
204 0.89
205 0.9
206 0.93
207 0.93
208 0.94
209 0.93
210 0.91
211 0.84
212 0.84
213 0.77
214 0.74
215 0.66
216 0.59
217 0.5
218 0.42
219 0.4
220 0.3
221 0.25
222 0.17
223 0.16
224 0.11
225 0.11
226 0.1
227 0.09
228 0.11
229 0.11
230 0.12
231 0.13
232 0.12
233 0.13
234 0.13
235 0.17
236 0.18
237 0.22
238 0.24
239 0.25
240 0.26
241 0.26
242 0.25
243 0.21