Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CTJ5

Protein Details
Accession A1CTJ5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
214-277VTDPPAREPKSRKKPGKKRRIQLRKRVTEAEEAKIKDAEKRTRKNRERKMKRRQKARELKAAAABasic
NLS Segment(s)
PositionSequence
220-273REPKSRKKPGKKRRIQLRKRVTEAEEAKIKDAEKRTRKNRERKMKRRQKARELK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG act:ACLA_083270  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPDAKRVRRDELLSGDLSSRSPSPAPESVAQDAQQRLRDLLNLDALLAPAQPSEPKQPSQDAGHASEDEEQEFEFRLFSAAPKPDAKNEKAPASGDAPASAGTQKLRIRLRSPTPGAVDGEGRFLNPFRGWEYYFTTPGLLTGSVGEEDAGAAERRRRFEEMAVTGEEMVGWSKGSWPGCHLPWRVIRLKRQHTKLPPASQDPAAIATVCVTDPPAREPKSRKKPGKKRRIQLRKRVTEAEEAKIKDAEKRTRKNRERKMKRRQKARELKAAAAAASGQSQDQEVPDTEMQDDSEASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.44
4 0.42
5 0.37
6 0.31
7 0.27
8 0.23
9 0.18
10 0.16
11 0.16
12 0.17
13 0.22
14 0.25
15 0.29
16 0.31
17 0.35
18 0.35
19 0.37
20 0.37
21 0.36
22 0.36
23 0.36
24 0.36
25 0.32
26 0.3
27 0.28
28 0.29
29 0.26
30 0.24
31 0.24
32 0.19
33 0.18
34 0.17
35 0.16
36 0.14
37 0.12
38 0.09
39 0.06
40 0.07
41 0.08
42 0.1
43 0.19
44 0.22
45 0.25
46 0.28
47 0.32
48 0.35
49 0.37
50 0.39
51 0.34
52 0.34
53 0.33
54 0.3
55 0.28
56 0.28
57 0.24
58 0.2
59 0.16
60 0.13
61 0.11
62 0.12
63 0.11
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.14
70 0.15
71 0.19
72 0.23
73 0.24
74 0.31
75 0.38
76 0.4
77 0.42
78 0.44
79 0.44
80 0.41
81 0.4
82 0.35
83 0.31
84 0.3
85 0.22
86 0.18
87 0.15
88 0.14
89 0.14
90 0.12
91 0.1
92 0.08
93 0.13
94 0.15
95 0.21
96 0.25
97 0.27
98 0.3
99 0.36
100 0.42
101 0.45
102 0.46
103 0.43
104 0.41
105 0.39
106 0.37
107 0.31
108 0.27
109 0.19
110 0.18
111 0.14
112 0.12
113 0.1
114 0.1
115 0.11
116 0.09
117 0.1
118 0.1
119 0.13
120 0.13
121 0.15
122 0.2
123 0.21
124 0.21
125 0.21
126 0.19
127 0.16
128 0.15
129 0.13
130 0.08
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.03
139 0.03
140 0.04
141 0.04
142 0.05
143 0.09
144 0.11
145 0.14
146 0.16
147 0.18
148 0.19
149 0.21
150 0.27
151 0.25
152 0.25
153 0.24
154 0.22
155 0.19
156 0.18
157 0.15
158 0.09
159 0.07
160 0.04
161 0.04
162 0.04
163 0.05
164 0.09
165 0.1
166 0.1
167 0.13
168 0.17
169 0.19
170 0.26
171 0.25
172 0.27
173 0.31
174 0.36
175 0.4
176 0.42
177 0.48
178 0.51
179 0.6
180 0.64
181 0.65
182 0.68
183 0.68
184 0.73
185 0.73
186 0.71
187 0.66
188 0.62
189 0.59
190 0.51
191 0.45
192 0.35
193 0.28
194 0.21
195 0.16
196 0.11
197 0.09
198 0.08
199 0.07
200 0.07
201 0.07
202 0.08
203 0.09
204 0.14
205 0.22
206 0.25
207 0.31
208 0.4
209 0.5
210 0.59
211 0.69
212 0.75
213 0.78
214 0.86
215 0.91
216 0.94
217 0.93
218 0.92
219 0.93
220 0.93
221 0.92
222 0.92
223 0.92
224 0.9
225 0.86
226 0.81
227 0.73
228 0.72
229 0.65
230 0.6
231 0.55
232 0.47
233 0.43
234 0.39
235 0.37
236 0.33
237 0.38
238 0.42
239 0.46
240 0.55
241 0.64
242 0.73
243 0.83
244 0.87
245 0.9
246 0.91
247 0.92
248 0.93
249 0.94
250 0.94
251 0.94
252 0.94
253 0.94
254 0.93
255 0.93
256 0.91
257 0.9
258 0.84
259 0.78
260 0.72
261 0.63
262 0.51
263 0.41
264 0.32
265 0.22
266 0.18
267 0.15
268 0.09
269 0.08
270 0.09
271 0.09
272 0.1
273 0.12
274 0.12
275 0.18
276 0.19
277 0.2
278 0.2
279 0.2
280 0.19
281 0.17