Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QLR5

Protein Details
Accession A0A2Z6QLR5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-106GQHKSRVKSVKQQKKKPETGSEKEKHNSVKKLKRERNLIIQKIHydrophilic
NLS Segment(s)
PositionSequence
68-99SRVKSVKQQKKKPETGSEKEKHNSVKKLKRER
Subcellular Location(s) nucl 6.5, pero 6, cyto_nucl 4.5, extr 4, E.R. 4, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MAFLTCLAILFIFASINKILEYLERFPKIFIGPKVQLSHISISPNKTLKCHINFNQNGYNINNGQHKSRVKSVKQQKKKPETGSEKEKHNSVKKLKRERNLIIQKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.08
6 0.08
7 0.11
8 0.15
9 0.17
10 0.24
11 0.26
12 0.26
13 0.26
14 0.28
15 0.28
16 0.29
17 0.27
18 0.28
19 0.28
20 0.32
21 0.34
22 0.33
23 0.32
24 0.28
25 0.28
26 0.22
27 0.24
28 0.21
29 0.22
30 0.25
31 0.27
32 0.26
33 0.24
34 0.26
35 0.29
36 0.31
37 0.37
38 0.36
39 0.42
40 0.43
41 0.46
42 0.47
43 0.41
44 0.39
45 0.32
46 0.31
47 0.21
48 0.23
49 0.23
50 0.19
51 0.2
52 0.25
53 0.27
54 0.28
55 0.35
56 0.41
57 0.4
58 0.5
59 0.59
60 0.64
61 0.71
62 0.77
63 0.8
64 0.81
65 0.86
66 0.83
67 0.83
68 0.81
69 0.79
70 0.81
71 0.75
72 0.72
73 0.66
74 0.64
75 0.62
76 0.61
77 0.62
78 0.62
79 0.67
80 0.7
81 0.78
82 0.82
83 0.82
84 0.84
85 0.81
86 0.82
87 0.83