Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CNE1

Protein Details
Accession A1CNE1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
240-259PSSGTGGSEKKKKDKKKGKABasic
NLS Segment(s)
PositionSequence
248-259EKKKKDKKKGKA
Subcellular Location(s) cyto 10, cyto_nucl 9.5, mito 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002778  Signal_recog_particle_SRP19  
IPR036521  SRP19-like_sf  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG act:ACLA_018660  -  
Pfam View protein in Pfam  
PF01922  SRP19  
Amino Acid Sequences MSRHAQVEEVYDSDPEEVAPSEPSASLLTPSAIPPPGASSIPTRPAPEPRREIPKHFQCLYPVYFDKTRSRAEGRKVGAELAIENPLARDIVDAVQSLGLNVGFEPEKLHPKDWANPGRVRVMLKDEDGNLVNPKIKNKHHLHILVAQYLKAHPTTEESPYRLRIRGLPMPEKLPGAPPAPRGWKIGKILPIHSPAYSGGGVSDNPLKDAMAEMQSMGGMPGMPQIPGMPDLAGLMGGEPSSGTGGSEKKKKDKKKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.1
4 0.09
5 0.1
6 0.11
7 0.11
8 0.11
9 0.11
10 0.12
11 0.12
12 0.12
13 0.12
14 0.11
15 0.12
16 0.12
17 0.12
18 0.14
19 0.14
20 0.14
21 0.13
22 0.15
23 0.17
24 0.16
25 0.17
26 0.19
27 0.23
28 0.28
29 0.3
30 0.3
31 0.31
32 0.41
33 0.46
34 0.49
35 0.51
36 0.52
37 0.6
38 0.61
39 0.66
40 0.66
41 0.69
42 0.68
43 0.63
44 0.59
45 0.52
46 0.54
47 0.48
48 0.43
49 0.35
50 0.33
51 0.33
52 0.35
53 0.38
54 0.37
55 0.38
56 0.37
57 0.42
58 0.43
59 0.47
60 0.51
61 0.47
62 0.47
63 0.45
64 0.4
65 0.34
66 0.28
67 0.22
68 0.15
69 0.14
70 0.1
71 0.09
72 0.08
73 0.08
74 0.07
75 0.06
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.05
88 0.04
89 0.06
90 0.05
91 0.05
92 0.07
93 0.09
94 0.16
95 0.18
96 0.19
97 0.22
98 0.24
99 0.31
100 0.38
101 0.42
102 0.4
103 0.41
104 0.42
105 0.4
106 0.39
107 0.33
108 0.26
109 0.23
110 0.2
111 0.18
112 0.18
113 0.15
114 0.16
115 0.15
116 0.15
117 0.11
118 0.11
119 0.14
120 0.13
121 0.17
122 0.21
123 0.22
124 0.31
125 0.35
126 0.38
127 0.42
128 0.43
129 0.42
130 0.42
131 0.42
132 0.36
133 0.31
134 0.27
135 0.2
136 0.19
137 0.17
138 0.11
139 0.1
140 0.07
141 0.11
142 0.13
143 0.18
144 0.21
145 0.22
146 0.24
147 0.29
148 0.31
149 0.28
150 0.27
151 0.25
152 0.29
153 0.32
154 0.35
155 0.35
156 0.35
157 0.35
158 0.36
159 0.33
160 0.27
161 0.24
162 0.22
163 0.19
164 0.19
165 0.2
166 0.24
167 0.28
168 0.3
169 0.31
170 0.31
171 0.34
172 0.35
173 0.38
174 0.39
175 0.36
176 0.37
177 0.37
178 0.39
179 0.34
180 0.31
181 0.27
182 0.21
183 0.22
184 0.19
185 0.14
186 0.11
187 0.11
188 0.11
189 0.11
190 0.16
191 0.12
192 0.13
193 0.14
194 0.13
195 0.12
196 0.13
197 0.14
198 0.11
199 0.11
200 0.1
201 0.1
202 0.1
203 0.1
204 0.08
205 0.06
206 0.04
207 0.04
208 0.08
209 0.08
210 0.08
211 0.08
212 0.08
213 0.1
214 0.11
215 0.12
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.06
222 0.05
223 0.05
224 0.05
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.06
231 0.09
232 0.15
233 0.22
234 0.3
235 0.37
236 0.47
237 0.57
238 0.67
239 0.75