Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RJT0

Protein Details
Accession A0A2Z6RJT0    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
121-151NEKEKDERDKEEKKRDKRKEKKEEGNEGEEEAcidic
NLS Segment(s)
PositionSequence
127-142ERDKEEKKRDKRKEKK
173-183RKLRKVYGKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MNKFKRPDNWMVYYKNNILTHLLEKLRSVRDVLADNIKNTISGKTYISTIIRKLGKGKKSVSQTQIAFAISTCELILNPENSDIHVNETVIKLFLIKNLKKIRENEDFYFYEESDERDEENEKEKDERDKEEKKRDKRKEKKEEGNEGEEEEDYEGTFSYQSSSDEQSKESMRKLRKVYGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.48
4 0.42
5 0.38
6 0.36
7 0.33
8 0.34
9 0.32
10 0.25
11 0.26
12 0.3
13 0.3
14 0.28
15 0.27
16 0.22
17 0.23
18 0.25
19 0.26
20 0.3
21 0.29
22 0.29
23 0.29
24 0.27
25 0.24
26 0.22
27 0.21
28 0.14
29 0.14
30 0.15
31 0.14
32 0.15
33 0.17
34 0.19
35 0.2
36 0.19
37 0.24
38 0.25
39 0.25
40 0.33
41 0.37
42 0.4
43 0.43
44 0.45
45 0.44
46 0.49
47 0.55
48 0.51
49 0.5
50 0.45
51 0.41
52 0.4
53 0.33
54 0.26
55 0.19
56 0.17
57 0.1
58 0.1
59 0.08
60 0.06
61 0.06
62 0.08
63 0.1
64 0.08
65 0.08
66 0.09
67 0.09
68 0.1
69 0.12
70 0.1
71 0.11
72 0.11
73 0.1
74 0.1
75 0.11
76 0.1
77 0.09
78 0.08
79 0.06
80 0.06
81 0.1
82 0.17
83 0.17
84 0.25
85 0.31
86 0.35
87 0.39
88 0.42
89 0.45
90 0.46
91 0.51
92 0.45
93 0.45
94 0.42
95 0.4
96 0.38
97 0.31
98 0.24
99 0.19
100 0.18
101 0.15
102 0.15
103 0.12
104 0.12
105 0.14
106 0.13
107 0.19
108 0.19
109 0.18
110 0.2
111 0.21
112 0.28
113 0.29
114 0.35
115 0.37
116 0.46
117 0.53
118 0.62
119 0.7
120 0.73
121 0.81
122 0.85
123 0.88
124 0.89
125 0.92
126 0.92
127 0.93
128 0.93
129 0.92
130 0.92
131 0.86
132 0.81
133 0.7
134 0.6
135 0.5
136 0.39
137 0.3
138 0.2
139 0.14
140 0.09
141 0.08
142 0.07
143 0.06
144 0.07
145 0.06
146 0.07
147 0.08
148 0.1
149 0.13
150 0.18
151 0.22
152 0.23
153 0.25
154 0.27
155 0.32
156 0.34
157 0.38
158 0.41
159 0.44
160 0.51
161 0.56
162 0.61
163 0.65