Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CJ71

Protein Details
Accession A1CJ71    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-38NPNLNPNPNPKPKPKHNHPLTLRHydrophilic
NLS Segment(s)
PositionSequence
94-127KRTGRPRREREREGEGEGGTSGEGKGKDKGKAKV
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
KEGG act:ACLA_033980  -  
Amino Acid Sequences MDQTVPPNTNPTPNLNPNLNPNPNPKPKPKHNHPLTLRVQALTLISIGVDIKSVQTSLRLPRQTILSWVAKARARGYNPQVDFRILPEYVEDGKRTGRPRREREREGEGEGGTSGEGKGKDKGKAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.47
4 0.49
5 0.56
6 0.55
7 0.5
8 0.51
9 0.55
10 0.61
11 0.65
12 0.66
13 0.67
14 0.72
15 0.78
16 0.81
17 0.83
18 0.8
19 0.84
20 0.79
21 0.8
22 0.74
23 0.71
24 0.62
25 0.51
26 0.43
27 0.33
28 0.29
29 0.19
30 0.14
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.09
44 0.13
45 0.2
46 0.21
47 0.21
48 0.23
49 0.25
50 0.24
51 0.24
52 0.24
53 0.18
54 0.18
55 0.18
56 0.2
57 0.2
58 0.21
59 0.21
60 0.22
61 0.23
62 0.28
63 0.32
64 0.37
65 0.37
66 0.39
67 0.37
68 0.34
69 0.32
70 0.27
71 0.26
72 0.18
73 0.16
74 0.13
75 0.15
76 0.16
77 0.17
78 0.17
79 0.14
80 0.17
81 0.22
82 0.28
83 0.34
84 0.41
85 0.5
86 0.59
87 0.69
88 0.77
89 0.78
90 0.79
91 0.79
92 0.73
93 0.67
94 0.61
95 0.49
96 0.4
97 0.33
98 0.27
99 0.17
100 0.14
101 0.09
102 0.1
103 0.11
104 0.13
105 0.19
106 0.23
107 0.31