Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QJX0

Protein Details
Accession A0A2Z6QJX0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTEIHCAKCKKKTKTSSEVQDMTHydrophilic
60-81LDAKEKRKKTATNKKAKKLGLKBasic
NLS Segment(s)
PositionSequence
62-78AKEKRKKTATNKKAKKL
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR044044  DUF5679  
Pfam View protein in Pfam  
PF18930  DUF5679  
Amino Acid Sequences MTEIHCAKCKKKTKTSSEVQDMTDKGRYRIHGDCITCGTHKNTLTGKNWEVKIHSKREVLDAKEKRKKTATNKKAKKLGLKILDADDKVQAYIKRYLKETTKED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.83
5 0.77
6 0.68
7 0.63
8 0.54
9 0.48
10 0.44
11 0.35
12 0.28
13 0.29
14 0.28
15 0.28
16 0.31
17 0.34
18 0.34
19 0.34
20 0.34
21 0.32
22 0.32
23 0.28
24 0.26
25 0.22
26 0.21
27 0.21
28 0.23
29 0.24
30 0.28
31 0.31
32 0.33
33 0.33
34 0.33
35 0.34
36 0.31
37 0.3
38 0.33
39 0.35
40 0.35
41 0.37
42 0.34
43 0.33
44 0.39
45 0.41
46 0.36
47 0.41
48 0.43
49 0.49
50 0.56
51 0.56
52 0.54
53 0.55
54 0.6
55 0.6
56 0.65
57 0.65
58 0.69
59 0.77
60 0.82
61 0.84
62 0.8
63 0.78
64 0.74
65 0.73
66 0.68
67 0.62
68 0.55
69 0.52
70 0.52
71 0.43
72 0.37
73 0.29
74 0.23
75 0.21
76 0.23
77 0.2
78 0.2
79 0.28
80 0.32
81 0.33
82 0.36
83 0.42
84 0.45