Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S4P7

Protein Details
Accession A0A2Z6S4P7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-47STATTIKSKRHPTKPKTNAKSINHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 4, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004214  Conotoxin  
Gene Ontology GO:0005576  C:extracellular region  
GO:0008200  F:ion channel inhibitor activity  
Pfam View protein in Pfam  
PF02950  Conotoxin  
Amino Acid Sequences MIFIVSLCFLTLNIEAHYQHQRRSSTATTIKSKRHPTKPKTNAKSINSPKICVPSGTFCSPNSKPPCCSGFCYRHKCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.18
4 0.28
5 0.27
6 0.29
7 0.34
8 0.34
9 0.33
10 0.39
11 0.38
12 0.36
13 0.41
14 0.43
15 0.45
16 0.49
17 0.52
18 0.54
19 0.62
20 0.62
21 0.66
22 0.71
23 0.71
24 0.77
25 0.82
26 0.85
27 0.8
28 0.8
29 0.78
30 0.72
31 0.74
32 0.69
33 0.69
34 0.6
35 0.56
36 0.49
37 0.45
38 0.42
39 0.32
40 0.28
41 0.24
42 0.28
43 0.3
44 0.3
45 0.26
46 0.33
47 0.34
48 0.4
49 0.42
50 0.41
51 0.4
52 0.44
53 0.49
54 0.45
55 0.49
56 0.49
57 0.52
58 0.58