Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RPY5

Protein Details
Accession A0A2Z6RPY5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-43NETQLPLPIKKKKKQKKNKKAKKTPTIAPPPTHydrophilic
NLS Segment(s)
PositionSequence
20-35IKKKKKQKKNKKAKKT
Subcellular Location(s) nucl 22.5, mito_nucl 13, mito 2.5
Family & Domain DBs
Amino Acid Sequences MSVSSDNNDFFNETQLPLPIKKKKKQKKNKKAKKTPTIAPPPTTPSEISLGAPWEYFYEDIITYIIMENFQGITASPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.21
4 0.22
5 0.3
6 0.35
7 0.43
8 0.5
9 0.6
10 0.67
11 0.76
12 0.83
13 0.87
14 0.89
15 0.91
16 0.95
17 0.95
18 0.96
19 0.95
20 0.94
21 0.89
22 0.84
23 0.82
24 0.81
25 0.72
26 0.64
27 0.55
28 0.49
29 0.44
30 0.39
31 0.3
32 0.21
33 0.21
34 0.19
35 0.18
36 0.15
37 0.14
38 0.13
39 0.12
40 0.11
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.08
47 0.09
48 0.09
49 0.08
50 0.08
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07