Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SNS5

Protein Details
Accession A0A2Z6SNS5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-125LRNSIFFKKHPRKKSSKFSSFSHydrophilic
NLS Segment(s)
PositionSequence
114-116PRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF09011  HMG_box_2  
Amino Acid Sequences MAENKFSIEFLAVSLIERINRKNIFPPLFNDPESFVPPPGSRSRRSPNSFLICRKNVHKEAKRRGSQNMRVISKAASILWNSASIEEKKAYKAIAERVYEIHLLRNSIFFKKHPRKKSSKFSSFSHQNPNPPLPLLSNTPETFPNITFSDSRLNLISNIDAYFNNDNQMVLFDYNDPDEQDYCLPYNGYNYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.18
5 0.2
6 0.25
7 0.27
8 0.29
9 0.35
10 0.43
11 0.44
12 0.44
13 0.46
14 0.46
15 0.48
16 0.47
17 0.41
18 0.35
19 0.33
20 0.34
21 0.31
22 0.24
23 0.23
24 0.22
25 0.26
26 0.32
27 0.34
28 0.33
29 0.4
30 0.49
31 0.55
32 0.61
33 0.61
34 0.61
35 0.65
36 0.68
37 0.67
38 0.66
39 0.59
40 0.57
41 0.57
42 0.57
43 0.56
44 0.6
45 0.62
46 0.64
47 0.71
48 0.78
49 0.78
50 0.72
51 0.74
52 0.73
53 0.73
54 0.71
55 0.68
56 0.59
57 0.54
58 0.52
59 0.43
60 0.34
61 0.26
62 0.18
63 0.12
64 0.1
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.12
71 0.11
72 0.12
73 0.13
74 0.13
75 0.13
76 0.14
77 0.13
78 0.12
79 0.14
80 0.18
81 0.22
82 0.22
83 0.22
84 0.22
85 0.23
86 0.23
87 0.21
88 0.18
89 0.13
90 0.13
91 0.12
92 0.15
93 0.15
94 0.16
95 0.18
96 0.16
97 0.27
98 0.37
99 0.46
100 0.52
101 0.59
102 0.67
103 0.75
104 0.84
105 0.84
106 0.83
107 0.78
108 0.72
109 0.73
110 0.7
111 0.65
112 0.65
113 0.57
114 0.53
115 0.53
116 0.52
117 0.44
118 0.37
119 0.33
120 0.25
121 0.24
122 0.22
123 0.21
124 0.23
125 0.22
126 0.23
127 0.23
128 0.24
129 0.23
130 0.2
131 0.21
132 0.17
133 0.19
134 0.18
135 0.19
136 0.24
137 0.22
138 0.23
139 0.2
140 0.2
141 0.19
142 0.2
143 0.18
144 0.12
145 0.12
146 0.12
147 0.11
148 0.15
149 0.18
150 0.17
151 0.18
152 0.17
153 0.16
154 0.15
155 0.17
156 0.14
157 0.11
158 0.12
159 0.11
160 0.13
161 0.15
162 0.16
163 0.15
164 0.15
165 0.15
166 0.17
167 0.17
168 0.18
169 0.18
170 0.18
171 0.18
172 0.16
173 0.19