Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S4R3

Protein Details
Accession A0A2Z6S4R3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SDNIKIKKYYKLKSRFSDIQHydrophilic
277-299IKAIYWYKKSAKQNYTNAQNKLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MSDNIKIKKYYKLKSRFSDIQQINEELSLDTIQNFDKIKEKEIEPTIQNIHENIFEEDLSIVIDNLVNFYFKEINEGKDYNLRQQHILNYLNEHKINLQEINNWLLNNQNDSNSIYLLGYFNCNGIGIDVNKQKAFKLYEKAVELENKAAQFDFAIMHMQGKVVGKNHDKTFELSKKLAEKEYPGGITLLGHCYDKGIGTDTNLQKAFELYQKSADLGNICGINNLGCYYNHGVGTDINKQKAVELYQKAADSGYNIAQYNLALMYENGNGIKKDIIKAIYWYKKSAKQNYTNAQNKLKELLNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.8
4 0.76
5 0.78
6 0.7
7 0.67
8 0.62
9 0.56
10 0.47
11 0.39
12 0.34
13 0.23
14 0.22
15 0.15
16 0.11
17 0.1
18 0.1
19 0.1
20 0.13
21 0.14
22 0.14
23 0.22
24 0.23
25 0.28
26 0.31
27 0.32
28 0.36
29 0.4
30 0.44
31 0.37
32 0.41
33 0.39
34 0.36
35 0.36
36 0.28
37 0.25
38 0.21
39 0.22
40 0.19
41 0.17
42 0.14
43 0.14
44 0.13
45 0.11
46 0.1
47 0.08
48 0.06
49 0.05
50 0.06
51 0.05
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.11
58 0.1
59 0.17
60 0.18
61 0.21
62 0.25
63 0.26
64 0.25
65 0.3
66 0.31
67 0.32
68 0.37
69 0.35
70 0.32
71 0.34
72 0.36
73 0.35
74 0.37
75 0.3
76 0.3
77 0.33
78 0.35
79 0.33
80 0.29
81 0.24
82 0.22
83 0.24
84 0.22
85 0.18
86 0.17
87 0.19
88 0.22
89 0.22
90 0.2
91 0.18
92 0.19
93 0.18
94 0.19
95 0.18
96 0.15
97 0.16
98 0.17
99 0.17
100 0.13
101 0.13
102 0.09
103 0.09
104 0.09
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.06
112 0.06
113 0.07
114 0.07
115 0.12
116 0.15
117 0.17
118 0.18
119 0.18
120 0.18
121 0.2
122 0.23
123 0.22
124 0.24
125 0.25
126 0.28
127 0.29
128 0.3
129 0.27
130 0.26
131 0.22
132 0.19
133 0.17
134 0.14
135 0.13
136 0.12
137 0.1
138 0.07
139 0.07
140 0.06
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.06
147 0.07
148 0.08
149 0.09
150 0.1
151 0.15
152 0.19
153 0.23
154 0.25
155 0.25
156 0.26
157 0.26
158 0.33
159 0.34
160 0.34
161 0.3
162 0.31
163 0.34
164 0.34
165 0.34
166 0.26
167 0.24
168 0.23
169 0.25
170 0.22
171 0.18
172 0.16
173 0.14
174 0.13
175 0.11
176 0.1
177 0.09
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.09
185 0.08
186 0.1
187 0.19
188 0.2
189 0.25
190 0.25
191 0.24
192 0.22
193 0.22
194 0.22
195 0.18
196 0.21
197 0.17
198 0.19
199 0.19
200 0.2
201 0.2
202 0.19
203 0.16
204 0.13
205 0.14
206 0.13
207 0.12
208 0.12
209 0.11
210 0.1
211 0.09
212 0.09
213 0.09
214 0.07
215 0.12
216 0.15
217 0.18
218 0.18
219 0.17
220 0.17
221 0.18
222 0.22
223 0.27
224 0.28
225 0.27
226 0.28
227 0.27
228 0.28
229 0.3
230 0.3
231 0.29
232 0.28
233 0.3
234 0.32
235 0.32
236 0.31
237 0.28
238 0.24
239 0.17
240 0.16
241 0.15
242 0.15
243 0.15
244 0.16
245 0.16
246 0.15
247 0.14
248 0.12
249 0.09
250 0.07
251 0.07
252 0.09
253 0.09
254 0.11
255 0.11
256 0.13
257 0.13
258 0.13
259 0.17
260 0.17
261 0.19
262 0.22
263 0.23
264 0.23
265 0.28
266 0.37
267 0.43
268 0.43
269 0.46
270 0.49
271 0.55
272 0.63
273 0.68
274 0.68
275 0.68
276 0.76
277 0.8
278 0.84
279 0.84
280 0.81
281 0.8
282 0.74
283 0.66
284 0.61