Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QQ03

Protein Details
Accession A0A2Z6QQ03    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-49VLYYRNKKRKDVEKKKPSKPKEKSIFPEBasic
NLS Segment(s)
PositionSequence
27-44NKKRKDVEKKKPSKPKEK
Subcellular Location(s) nucl 9.5, cyto_nucl 7.5, E.R. 7, cyto 4.5, vacu 2, mito 1, extr 1, pero 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFFNLNSDFIKVIAAIALVGTVLYYRNKKRKDVEKKKPSKPKEKSIFPEPTDESTITGTSLKEKPEETPLLQDSSDIPNKSEENSTDKWVIINFDEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.03
9 0.05
10 0.09
11 0.15
12 0.23
13 0.32
14 0.36
15 0.43
16 0.52
17 0.61
18 0.69
19 0.74
20 0.77
21 0.8
22 0.86
23 0.9
24 0.91
25 0.89
26 0.89
27 0.85
28 0.84
29 0.82
30 0.8
31 0.76
32 0.74
33 0.73
34 0.63
35 0.6
36 0.51
37 0.44
38 0.38
39 0.32
40 0.25
41 0.18
42 0.17
43 0.13
44 0.12
45 0.1
46 0.12
47 0.14
48 0.14
49 0.15
50 0.15
51 0.17
52 0.22
53 0.25
54 0.22
55 0.25
56 0.26
57 0.26
58 0.25
59 0.24
60 0.2
61 0.23
62 0.27
63 0.23
64 0.22
65 0.23
66 0.24
67 0.26
68 0.28
69 0.24
70 0.25
71 0.27
72 0.31
73 0.29
74 0.29
75 0.28
76 0.25
77 0.26
78 0.22