Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RER7

Protein Details
Accession A0A2Z6RER7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-83RNTVQCWYKKERPIRPMPKDRTKIFAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MTISRYLANYGYKKAILRATSMLTAAYKQKRVEWAQNHLNDDWSLTLFSDETAFQLFRNTVQCWYKKERPIRPMPKDRTKIFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.28
4 0.28
5 0.27
6 0.26
7 0.25
8 0.24
9 0.21
10 0.16
11 0.16
12 0.21
13 0.22
14 0.24
15 0.24
16 0.26
17 0.32
18 0.36
19 0.43
20 0.4
21 0.44
22 0.47
23 0.5
24 0.5
25 0.43
26 0.4
27 0.31
28 0.26
29 0.19
30 0.12
31 0.09
32 0.06
33 0.06
34 0.05
35 0.05
36 0.06
37 0.05
38 0.06
39 0.07
40 0.07
41 0.07
42 0.09
43 0.09
44 0.11
45 0.14
46 0.15
47 0.2
48 0.26
49 0.3
50 0.34
51 0.43
52 0.49
53 0.54
54 0.62
55 0.66
56 0.69
57 0.77
58 0.81
59 0.83
60 0.85
61 0.87
62 0.88
63 0.87