Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RK86

Protein Details
Accession A0A2Z6RK86    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-131MAEATKKNKNSQNNDKQPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9.5, extr 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036869  J_dom_sf  
IPR005341  Tim16  
Gene Ontology GO:0005744  C:TIM23 mitochondrial import inner membrane translocase complex  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF03656  Pam16  
Amino Acid Sequences MSARVIAQVIVLGTQILGKAFVEAYKQAVANAAGGGAVGSAGRLGKDSLTRQTGMTIEEAYKILNLKKDNFDVSTFAKNYEHLFKVNDTSSGGSFYIQSKVMRAKERIDMEMAEATKKNKNSQNNDKQPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.05
6 0.06
7 0.07
8 0.07
9 0.09
10 0.09
11 0.12
12 0.13
13 0.13
14 0.12
15 0.14
16 0.14
17 0.12
18 0.11
19 0.09
20 0.06
21 0.06
22 0.06
23 0.03
24 0.03
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.06
33 0.09
34 0.12
35 0.16
36 0.18
37 0.19
38 0.19
39 0.2
40 0.19
41 0.17
42 0.15
43 0.12
44 0.09
45 0.1
46 0.09
47 0.08
48 0.08
49 0.08
50 0.09
51 0.12
52 0.13
53 0.15
54 0.17
55 0.19
56 0.2
57 0.2
58 0.19
59 0.18
60 0.19
61 0.22
62 0.2
63 0.19
64 0.18
65 0.18
66 0.19
67 0.22
68 0.2
69 0.17
70 0.18
71 0.18
72 0.21
73 0.2
74 0.19
75 0.15
76 0.15
77 0.14
78 0.15
79 0.14
80 0.11
81 0.11
82 0.12
83 0.13
84 0.14
85 0.14
86 0.15
87 0.22
88 0.27
89 0.32
90 0.33
91 0.35
92 0.4
93 0.43
94 0.42
95 0.37
96 0.32
97 0.28
98 0.3
99 0.28
100 0.23
101 0.22
102 0.23
103 0.27
104 0.3
105 0.35
106 0.38
107 0.48
108 0.55
109 0.64
110 0.73
111 0.78