Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6REK2

Protein Details
Accession A0A2Z6REK2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
220-256GNKTGGKNKKSQKTNDKSTGTSPPKKLSKRQLHAEIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.166, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MAKPFVSRTNGEKNKQKSNDLGEDATHIITGYRPNLSLGQYVRDILVYDVPAKRSIKWFSFPASWSLKERKEKERFQAVVQGSPDSFTADALAVKEHLTNFVYPLHIKAFKEVKNPDGTRKMIAYFKSWEDLQNIISKESFWNRTKLSWYHHIVPSFITRRKSSQQFSSNRQDKPNKLIQDPPSKRTKLSSRSKTDSPATGSNRVPIRSLLKDSSQLSSGNKTGGKNKKSQKTNDKSTGTSPPKKLSKRQLHAEIVELKTVLMDFIQKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.7
4 0.65
5 0.65
6 0.65
7 0.6
8 0.55
9 0.45
10 0.42
11 0.39
12 0.32
13 0.23
14 0.15
15 0.11
16 0.11
17 0.14
18 0.14
19 0.14
20 0.14
21 0.16
22 0.19
23 0.21
24 0.24
25 0.22
26 0.23
27 0.22
28 0.23
29 0.21
30 0.18
31 0.17
32 0.13
33 0.14
34 0.12
35 0.15
36 0.17
37 0.18
38 0.23
39 0.24
40 0.25
41 0.29
42 0.34
43 0.34
44 0.36
45 0.37
46 0.37
47 0.39
48 0.38
49 0.38
50 0.37
51 0.35
52 0.36
53 0.41
54 0.43
55 0.49
56 0.53
57 0.57
58 0.62
59 0.66
60 0.68
61 0.72
62 0.66
63 0.59
64 0.61
65 0.52
66 0.47
67 0.41
68 0.35
69 0.24
70 0.23
71 0.21
72 0.14
73 0.13
74 0.08
75 0.08
76 0.07
77 0.08
78 0.07
79 0.07
80 0.06
81 0.07
82 0.08
83 0.07
84 0.09
85 0.09
86 0.09
87 0.1
88 0.11
89 0.12
90 0.11
91 0.12
92 0.14
93 0.16
94 0.16
95 0.21
96 0.26
97 0.27
98 0.34
99 0.34
100 0.34
101 0.39
102 0.41
103 0.41
104 0.4
105 0.39
106 0.33
107 0.33
108 0.31
109 0.26
110 0.26
111 0.23
112 0.2
113 0.19
114 0.2
115 0.19
116 0.18
117 0.17
118 0.16
119 0.14
120 0.17
121 0.16
122 0.15
123 0.14
124 0.13
125 0.13
126 0.16
127 0.22
128 0.19
129 0.22
130 0.22
131 0.24
132 0.28
133 0.29
134 0.31
135 0.32
136 0.35
137 0.36
138 0.39
139 0.38
140 0.34
141 0.32
142 0.34
143 0.32
144 0.32
145 0.3
146 0.28
147 0.32
148 0.39
149 0.44
150 0.42
151 0.44
152 0.5
153 0.52
154 0.58
155 0.64
156 0.64
157 0.6
158 0.64
159 0.63
160 0.57
161 0.58
162 0.58
163 0.52
164 0.47
165 0.51
166 0.51
167 0.55
168 0.56
169 0.54
170 0.55
171 0.52
172 0.5
173 0.5
174 0.51
175 0.5
176 0.57
177 0.62
178 0.62
179 0.66
180 0.68
181 0.67
182 0.61
183 0.55
184 0.49
185 0.48
186 0.44
187 0.43
188 0.41
189 0.42
190 0.42
191 0.39
192 0.35
193 0.3
194 0.31
195 0.29
196 0.34
197 0.31
198 0.3
199 0.34
200 0.35
201 0.34
202 0.3
203 0.28
204 0.25
205 0.27
206 0.25
207 0.24
208 0.25
209 0.25
210 0.33
211 0.41
212 0.43
213 0.48
214 0.57
215 0.62
216 0.68
217 0.76
218 0.77
219 0.78
220 0.83
221 0.84
222 0.79
223 0.72
224 0.68
225 0.69
226 0.67
227 0.66
228 0.61
229 0.6
230 0.65
231 0.69
232 0.74
233 0.75
234 0.76
235 0.76
236 0.81
237 0.81
238 0.79
239 0.73
240 0.7
241 0.67
242 0.57
243 0.5
244 0.4
245 0.3
246 0.24
247 0.22
248 0.16
249 0.09
250 0.11