Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S2Z5

Protein Details
Accession A0A2Z6S2Z5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-53APTYRKLRSSRASRGKNNKKKYNKPSKSHRRKHFKKMSSKASPSKKVHydrophilic
104-124SLTNKNKERYRREREGWKVRYHydrophilic
NLS Segment(s)
PositionSequence
11-51RKLRSSRASRGKNNKKKYNKPSKSHRRKHFKKMSSKASPSK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MTRITTAPTYRKLRSSRASRGKNNKKKYNKPSKSHRRKHFKKMSSKASPSKKVTQQTLEVAGELFVTKEEEVEKLQQEINKKNGELGHYKEXAGFNRDLREQVFSLTNKNKERYRREREGWKVRYEREYKRPNEVKETISNYETYMRKNNLEPLSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.68
4 0.72
5 0.77
6 0.8
7 0.86
8 0.89
9 0.89
10 0.91
11 0.9
12 0.9
13 0.91
14 0.92
15 0.93
16 0.91
17 0.9
18 0.91
19 0.92
20 0.93
21 0.92
22 0.92
23 0.91
24 0.9
25 0.92
26 0.92
27 0.89
28 0.89
29 0.88
30 0.88
31 0.86
32 0.85
33 0.82
34 0.81
35 0.8
36 0.74
37 0.73
38 0.7
39 0.66
40 0.63
41 0.57
42 0.51
43 0.45
44 0.44
45 0.36
46 0.29
47 0.23
48 0.18
49 0.14
50 0.1
51 0.08
52 0.04
53 0.05
54 0.04
55 0.05
56 0.05
57 0.06
58 0.07
59 0.1
60 0.1
61 0.1
62 0.12
63 0.13
64 0.17
65 0.2
66 0.24
67 0.23
68 0.22
69 0.23
70 0.23
71 0.25
72 0.24
73 0.24
74 0.24
75 0.24
76 0.24
77 0.25
78 0.25
79 0.24
80 0.22
81 0.2
82 0.19
83 0.21
84 0.22
85 0.19
86 0.21
87 0.19
88 0.19
89 0.22
90 0.19
91 0.23
92 0.29
93 0.35
94 0.37
95 0.42
96 0.46
97 0.5
98 0.6
99 0.63
100 0.67
101 0.69
102 0.71
103 0.76
104 0.82
105 0.83
106 0.78
107 0.77
108 0.74
109 0.69
110 0.71
111 0.68
112 0.66
113 0.65
114 0.7
115 0.64
116 0.69
117 0.72
118 0.68
119 0.69
120 0.64
121 0.59
122 0.57
123 0.6
124 0.53
125 0.46
126 0.42
127 0.35
128 0.39
129 0.36
130 0.33
131 0.35
132 0.35
133 0.37
134 0.39
135 0.47
136 0.44