Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RWH8

Protein Details
Accession A0A2Z6RWH8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-36FNPNSRKASRHERKKDNNNSDNSGHydrophilic
NLS Segment(s)
PositionSequence
18-26RKASRHERK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPNNVARRGRGSFNPNSRKASRHERKKDNNNSDNSGSDAADVEVEGPSSPPKENNTASNFSLLPPEYGCGSFCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.65
4 0.62
5 0.59
6 0.58
7 0.6
8 0.6
9 0.61
10 0.67
11 0.71
12 0.79
13 0.86
14 0.91
15 0.9
16 0.87
17 0.8
18 0.75
19 0.66
20 0.56
21 0.46
22 0.36
23 0.25
24 0.18
25 0.14
26 0.09
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.07
36 0.08
37 0.1
38 0.13
39 0.19
40 0.22
41 0.28
42 0.33
43 0.36
44 0.36
45 0.36
46 0.33
47 0.28
48 0.3
49 0.24
50 0.2
51 0.16
52 0.17
53 0.16
54 0.17