Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SCB5

Protein Details
Accession A0A2Z6SCB5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-51SLIKITPKGKGKKKKNKQKTISYDNIDHydrophilic
NLS Segment(s)
PositionSequence
30-42TPKGKGKKKKNKQ
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MDMDISSPDPHQSTPSQPHTKAINSLIKITPKGKGKKKKNKQKTISYDNIDKDFRFPIDSEAEFIQVLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.46
4 0.45
5 0.49
6 0.49
7 0.48
8 0.44
9 0.42
10 0.39
11 0.33
12 0.35
13 0.34
14 0.32
15 0.32
16 0.3
17 0.29
18 0.31
19 0.38
20 0.44
21 0.52
22 0.61
23 0.7
24 0.79
25 0.85
26 0.88
27 0.91
28 0.9
29 0.91
30 0.89
31 0.86
32 0.84
33 0.77
34 0.73
35 0.65
36 0.6
37 0.52
38 0.42
39 0.36
40 0.3
41 0.26
42 0.22
43 0.19
44 0.19
45 0.22
46 0.23
47 0.23
48 0.22
49 0.22
50 0.2