Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S2E8

Protein Details
Accession A0A2Z6S2E8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
199-242GEEAKKNKKEMPKEDKKYKKKSSKNYESGIKNKKLRRRNLLTDNBasic
NLS Segment(s)
PositionSequence
202-236AKKNKKEMPKEDKKYKKKSSKNYESGIKNKKLRRR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000999  RNase_III_dom  
IPR036389  RNase_III_sf  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
PROSITE View protein in PROSITE  
PS50142  RNASE_3_2  
Amino Acid Sequences MFQTFKNLLKSIDYISLIVRHQNQPSRTVSRLYNSKVITLPGINDEKLRCSIIEYINMKIHNNFNENNKNYEFYRFYGDRAYNYFVMRELNLKFPDTTNENFMKILDTLVSRNFLSKVVKDFKLVEMLPDVSNMNNDNNDFDEILEIYYSGMLFNGMEEEMKKFTSDVIDYYFAKNENKFTIAENDDGIVKENITNKIGEEAKKNKKEMPKEDKKYKKKSSKNYESGIKNKKLRRRNLLTDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.23
5 0.26
6 0.29
7 0.29
8 0.35
9 0.42
10 0.42
11 0.44
12 0.5
13 0.5
14 0.47
15 0.46
16 0.43
17 0.43
18 0.49
19 0.48
20 0.48
21 0.43
22 0.43
23 0.41
24 0.38
25 0.33
26 0.26
27 0.23
28 0.21
29 0.24
30 0.21
31 0.23
32 0.22
33 0.23
34 0.24
35 0.23
36 0.18
37 0.17
38 0.22
39 0.22
40 0.29
41 0.28
42 0.29
43 0.32
44 0.33
45 0.32
46 0.29
47 0.31
48 0.27
49 0.29
50 0.28
51 0.33
52 0.42
53 0.43
54 0.44
55 0.41
56 0.39
57 0.37
58 0.39
59 0.34
60 0.25
61 0.31
62 0.27
63 0.26
64 0.3
65 0.31
66 0.27
67 0.28
68 0.3
69 0.24
70 0.24
71 0.23
72 0.17
73 0.17
74 0.16
75 0.16
76 0.14
77 0.17
78 0.18
79 0.19
80 0.19
81 0.18
82 0.21
83 0.21
84 0.21
85 0.21
86 0.21
87 0.2
88 0.2
89 0.19
90 0.17
91 0.14
92 0.13
93 0.08
94 0.08
95 0.08
96 0.09
97 0.1
98 0.09
99 0.1
100 0.1
101 0.11
102 0.12
103 0.13
104 0.18
105 0.21
106 0.22
107 0.22
108 0.23
109 0.22
110 0.24
111 0.23
112 0.17
113 0.14
114 0.14
115 0.13
116 0.13
117 0.12
118 0.08
119 0.09
120 0.09
121 0.09
122 0.08
123 0.09
124 0.09
125 0.1
126 0.11
127 0.1
128 0.09
129 0.08
130 0.08
131 0.07
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.05
146 0.07
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.11
153 0.11
154 0.11
155 0.13
156 0.16
157 0.17
158 0.18
159 0.19
160 0.18
161 0.21
162 0.21
163 0.2
164 0.19
165 0.2
166 0.19
167 0.2
168 0.25
169 0.24
170 0.23
171 0.21
172 0.19
173 0.19
174 0.18
175 0.19
176 0.12
177 0.1
178 0.12
179 0.17
180 0.19
181 0.19
182 0.19
183 0.17
184 0.23
185 0.26
186 0.26
187 0.3
188 0.37
189 0.47
190 0.53
191 0.56
192 0.56
193 0.61
194 0.68
195 0.71
196 0.72
197 0.73
198 0.76
199 0.85
200 0.89
201 0.91
202 0.91
203 0.92
204 0.91
205 0.9
206 0.92
207 0.92
208 0.92
209 0.91
210 0.87
211 0.86
212 0.83
213 0.83
214 0.82
215 0.8
216 0.77
217 0.77
218 0.79
219 0.79
220 0.81
221 0.82
222 0.81